Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017158335             607 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068645), mRNA.
ACCESSION   XM_017158335
VERSION     XM_017158335.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158335.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..607
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..607
                     /gene="LOC108068645"
                     /note="uncharacterized LOC108068645; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 4
                     Proteins"
                     /db_xref="GeneID:108068645"
     CDS             2..607
                     /gene="LOC108068645"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017013824.3"
                     /db_xref="GeneID:108068645"
                     /translation="MAKSAIPKRNCISHFWSELNNINKITKMCALRQVYKTSVGVARR
                     TLFASGRITQIDALNHPHFPLQLQYFATKTQTAVLKNNNNYTCTCRSLHCSKPVEDAE
                     KTVASSSVPLAKLESKMQLIYTCKVCQTRNMKTISKVAYQRGVVIVTCEGCSNHHLIA
                     DNLNWFTDLEGKRNIEEILAEKGEKVVRLSDGNCEFLPKSD"
     misc_feature    359..556
                     /gene="LOC108068645"
                     /note="DNL zinc finger; Region: zf-DNL; pfam05180"
                     /db_xref="CDD:461571"
ORIGIN      
        1 catggccaaa agtgccatcc ctaagcgcaa ctgtatttca cacttctggt cggaattaaa
       61 taatatcaat aaaatcacga aaatgtgcgc cctacggcaa gtgtacaaaa ccagcgtagg
      121 cgtggcacga cgtaccctat tcgcgagtgg ccgaattaca caaatagatg ctttgaatca
      181 tccgcacttt ccgttgcaat tgcaatattt tgcaaccaaa acacaaacag ctgttttgaa
      241 gaacaacaac aactacacgt gcacttgccg cagtttgcac tgcagcaaac cggtggaaga
      301 tgcggagaag acggtggcct ccagcagcgt tcccctggcg aaactagagt ccaagatgca
      361 gctgatctac acctgcaaag tgtgccagac gcggaacatg aagaccattt cgaaggtggc
      421 ctaccagcgc ggcgtcgtca tcgtgacctg cgagggctgc tccaatcacc acctgatcgc
      481 cgacaatctc aactggttca ccgatctgga gggcaagcgc aacatcgagg agatcctggc
      541 ggagaagggc gagaaggtgg ttcgcctgag cgacggcaac tgcgagtttc tgcccaaaag
      601 cgattaa