Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017158335 607 bp mRNA linear INV 09-DEC-2024 (LOC108068645), mRNA. ACCESSION XM_017158335 VERSION XM_017158335.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017158335.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..607 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..607 /gene="LOC108068645" /note="uncharacterized LOC108068645; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108068645" CDS 2..607 /gene="LOC108068645" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017013824.3" /db_xref="GeneID:108068645" /translation="MAKSAIPKRNCISHFWSELNNINKITKMCALRQVYKTSVGVARR TLFASGRITQIDALNHPHFPLQLQYFATKTQTAVLKNNNNYTCTCRSLHCSKPVEDAE KTVASSSVPLAKLESKMQLIYTCKVCQTRNMKTISKVAYQRGVVIVTCEGCSNHHLIA DNLNWFTDLEGKRNIEEILAEKGEKVVRLSDGNCEFLPKSD" misc_feature 359..556 /gene="LOC108068645" /note="DNL zinc finger; Region: zf-DNL; pfam05180" /db_xref="CDD:461571" ORIGIN 1 catggccaaa agtgccatcc ctaagcgcaa ctgtatttca cacttctggt cggaattaaa 61 taatatcaat aaaatcacga aaatgtgcgc cctacggcaa gtgtacaaaa ccagcgtagg 121 cgtggcacga cgtaccctat tcgcgagtgg ccgaattaca caaatagatg ctttgaatca 181 tccgcacttt ccgttgcaat tgcaatattt tgcaaccaaa acacaaacag ctgttttgaa 241 gaacaacaac aactacacgt gcacttgccg cagtttgcac tgcagcaaac cggtggaaga 301 tgcggagaag acggtggcct ccagcagcgt tcccctggcg aaactagagt ccaagatgca 361 gctgatctac acctgcaaag tgtgccagac gcggaacatg aagaccattt cgaaggtggc 421 ctaccagcgc ggcgtcgtca tcgtgacctg cgagggctgc tccaatcacc acctgatcgc 481 cgacaatctc aactggttca ccgatctgga gggcaagcgc aacatcgagg agatcctggc 541 ggagaagggc gagaaggtgg ttcgcctgag cgacggcaac tgcgagtttc tgcccaaaag 601 cgattaa