Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017158334 1066 bp mRNA linear INV 09-DEC-2024 (LOC108068644), mRNA. ACCESSION XM_017158334 VERSION XM_017158334.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017158334.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1066 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1066 /gene="LOC108068644" /note="uncharacterized LOC108068644; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108068644" CDS 20..1057 /gene="LOC108068644" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017013823.2" /db_xref="GeneID:108068644" /translation="MDLFIRKELILAKETGLEDVAPQCLKLLTWLQGCQEEMRSQQRH LRLSQSLIESLLKAYLYLFECYDRFGESLADRCDSSGFFAGCSAPEDRRQCIRELCTS IVRTRKGEAHAPLLHLMHRTLAEIQPAWSVIRDLDWSELRQTESLCCSDLISPDLQQM RRLVKRLGRLSSRQHMETALQRAMQLVGFPVWLHLFRESRESEIHSDCHLVRHMICDT LTEGGTPACSGFLHNIYLFVAQPAQEMRFCACLEHVRLAGSLSSYLTGHWSRQLPYLD LDEMQLSAEVPVMAIPELPLNEAIFVTHLMLTTGSPARRQFAQQLRTQLPAQLFAQLL ELLNKVAYVFS" ORIGIN 1 tcgattgtgg tcacatcata tggatttgtt tatcaggaag gagctgattt tggccaagga 61 aactggactg gaggatgtgg cgccgcagtg cctcaagctg ctcacgtggc tgcaggggtg 121 ccaggaggag atgcgctccc agcagcgcca cctgcggctc agccaatccc tgatagaatc 181 cttgctgaag gcttacctct acctgttcga gtgctacgat cgcttcggag aatcgctggc 241 cgatcgctgc gattccagtg gcttctttgc gggctgctcc gctccggagg atcggaggca 301 gtgcatccgg gagctgtgca cgagtattgt gcggacaagg aaaggggagg cccatgcgcc 361 gctgctgcat ctaatgcacc gcactctcgc cgagattcag cccgcctgga gtgtgatccg 421 tgacctggac tggagcgagt tgcgccagac ggagtcgctc tgctgcagcg acctcatcag 481 ccccgatctc cagcagatgc gccgcttggt gaagcggctg ggccgcctgt ccagccgcca 541 gcacatggag accgccctgc agcgcgccat gcagctggtg ggcttcccgg tgtggctgca 601 cctctttcgg gagtccaggg aaagcgagat ccactcggac tgccacctag tgcgccacat 661 gatctgcgat acgctgacgg agggcggaac acccgcctgt tccggcttcc tgcacaatat 721 ctacctgttt gtagcgcaac ccgcccagga aatgaggttc tgcgcctgtc tggagcatgt 781 gcgtctggcc gggagcctaa gtagctacct aactggccac tggagccgtc agctgcctta 841 tttggacctg gatgaaatgc aactgagcgc agaggttcct gtaatggcta tcccggaatt 901 gcccttaaac gaagccatct ttgtgaccca cctgatgctg accaccggat ctccggctcg 961 tcgccagttc gcccagcagc tgcgcaccca gctgcccgcc caattattcg cccagctgct 1021 ggagctgctc aataaagtgg cctatgtttt tagttaatta caattt