Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017158334            1066 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068644), mRNA.
ACCESSION   XM_017158334
VERSION     XM_017158334.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158334.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1066
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1066
                     /gene="LOC108068644"
                     /note="uncharacterized LOC108068644; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108068644"
     CDS             20..1057
                     /gene="LOC108068644"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017013823.2"
                     /db_xref="GeneID:108068644"
                     /translation="MDLFIRKELILAKETGLEDVAPQCLKLLTWLQGCQEEMRSQQRH
                     LRLSQSLIESLLKAYLYLFECYDRFGESLADRCDSSGFFAGCSAPEDRRQCIRELCTS
                     IVRTRKGEAHAPLLHLMHRTLAEIQPAWSVIRDLDWSELRQTESLCCSDLISPDLQQM
                     RRLVKRLGRLSSRQHMETALQRAMQLVGFPVWLHLFRESRESEIHSDCHLVRHMICDT
                     LTEGGTPACSGFLHNIYLFVAQPAQEMRFCACLEHVRLAGSLSSYLTGHWSRQLPYLD
                     LDEMQLSAEVPVMAIPELPLNEAIFVTHLMLTTGSPARRQFAQQLRTQLPAQLFAQLL
                     ELLNKVAYVFS"
ORIGIN      
        1 tcgattgtgg tcacatcata tggatttgtt tatcaggaag gagctgattt tggccaagga
       61 aactggactg gaggatgtgg cgccgcagtg cctcaagctg ctcacgtggc tgcaggggtg
      121 ccaggaggag atgcgctccc agcagcgcca cctgcggctc agccaatccc tgatagaatc
      181 cttgctgaag gcttacctct acctgttcga gtgctacgat cgcttcggag aatcgctggc
      241 cgatcgctgc gattccagtg gcttctttgc gggctgctcc gctccggagg atcggaggca
      301 gtgcatccgg gagctgtgca cgagtattgt gcggacaagg aaaggggagg cccatgcgcc
      361 gctgctgcat ctaatgcacc gcactctcgc cgagattcag cccgcctgga gtgtgatccg
      421 tgacctggac tggagcgagt tgcgccagac ggagtcgctc tgctgcagcg acctcatcag
      481 ccccgatctc cagcagatgc gccgcttggt gaagcggctg ggccgcctgt ccagccgcca
      541 gcacatggag accgccctgc agcgcgccat gcagctggtg ggcttcccgg tgtggctgca
      601 cctctttcgg gagtccaggg aaagcgagat ccactcggac tgccacctag tgcgccacat
      661 gatctgcgat acgctgacgg agggcggaac acccgcctgt tccggcttcc tgcacaatat
      721 ctacctgttt gtagcgcaac ccgcccagga aatgaggttc tgcgcctgtc tggagcatgt
      781 gcgtctggcc gggagcctaa gtagctacct aactggccac tggagccgtc agctgcctta
      841 tttggacctg gatgaaatgc aactgagcgc agaggttcct gtaatggcta tcccggaatt
      901 gcccttaaac gaagccatct ttgtgaccca cctgatgctg accaccggat ctccggctcg
      961 tcgccagttc gcccagcagc tgcgcaccca gctgcccgcc caattattcg cccagctgct
     1021 ggagctgctc aataaagtgg cctatgtttt tagttaatta caattt