Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii mitochondrial inner membrane


LOCUS       XM_017158322             931 bp    mRNA    linear   INV 09-DEC-2024
            protease subunit 1 (LOC108068636), mRNA.
ACCESSION   XM_017158322
VERSION     XM_017158322.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158322.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..931
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..931
                     /gene="LOC108068636"
                     /note="mitochondrial inner membrane protease subunit 1;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 Proteins"
                     /db_xref="GeneID:108068636"
     CDS             105..614
                     /gene="LOC108068636"
                     /codon_start=1
                     /product="mitochondrial inner membrane protease subunit 1"
                     /protein_id="XP_017013811.2"
                     /db_xref="GeneID:108068636"
                     /translation="MKILSRLGRLMRYTVAYAAITHCTFEYIGDFVLCKGPSMEPTLY
                     SDNVLLTERLSKHWRTYQPGDIVIAVSPINAGQFICKRIVAVSGDQVLTQKPSPIEAE
                     YSRSQDGAAAGKKPVMTKDYVPRNYVWLEGDNKGNSSDSRYYGPIPVGLIRSRVLCRI
                     WPISEATGL"
     misc_feature    192..590
                     /gene="LOC108068636"
                     /note="signal peptidase I, bacterial type; Region:
                     sigpep_I_bact; TIGR02227"
                     /db_xref="CDD:274044"
     polyA_site      931
                     /gene="LOC108068636"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgcacttccg ggaccataac agatagcagc gccagaggat taggacatcg ggagatgctc
       61 tgataacggg cggatgtgga tcagccaacg ccggaatcgc cgccatgaag atcctctccc
      121 gtctgggccg cctgatgcgg tacacggtgg cctatgcggc catcacacac tgcacctttg
      181 agtacatagg cgactttgtc ctgtgcaagg gaccctccat ggagcccacc ctctactcgg
      241 acaatgtgct gctcaccgag cgcctgtcga agcactggcg aacctaccag ccgggcgaca
      301 tcgtcatcgc cgtctcgccc atcaacgccg gccagttcat ctgcaaacgg atcgtggccg
      361 tgtccggtga ccaggtgctc acccagaagc cgagccccat tgaggcggag tacagccgaa
      421 gtcaggatgg cgccgccgcc ggcaagaagc ccgtgatgac caaggactat gtgccgcgca
      481 attacgtttg gctcgagggc gacaacaagg gcaacagctc ggattcgcgc tactatggac
      541 ccattccggt gggcctgatc cggagtcggg tgctctgccg catctggccg atttccgagg
      601 ccaccgggct gtagattggc tagcccaaga agaagtttta aatcaattgg acctattttg
      661 ttttttatag caaattgtag tatatcaatc caatatttta tagatccatt tcgtaccaat
      721 ggatgtcata tacttgaaca actgccaata acatatttat tcatatattt atttacactt
      781 ccgaaaatgg tctcttattg aattttaaaa tattcttgaa atcatcaaat taaaaaccat
      841 gtaaattgca aaattggctt tgcttataca ttttgtagat aaaatacgtt gataaaatat
      901 aaaaatacat acttgtgatt atgaatagaa a