Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017158322 931 bp mRNA linear INV 09-DEC-2024 protease subunit 1 (LOC108068636), mRNA. ACCESSION XM_017158322 VERSION XM_017158322.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017158322.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..931 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..931 /gene="LOC108068636" /note="mitochondrial inner membrane protease subunit 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108068636" CDS 105..614 /gene="LOC108068636" /codon_start=1 /product="mitochondrial inner membrane protease subunit 1" /protein_id="XP_017013811.2" /db_xref="GeneID:108068636" /translation="MKILSRLGRLMRYTVAYAAITHCTFEYIGDFVLCKGPSMEPTLY SDNVLLTERLSKHWRTYQPGDIVIAVSPINAGQFICKRIVAVSGDQVLTQKPSPIEAE YSRSQDGAAAGKKPVMTKDYVPRNYVWLEGDNKGNSSDSRYYGPIPVGLIRSRVLCRI WPISEATGL" misc_feature 192..590 /gene="LOC108068636" /note="signal peptidase I, bacterial type; Region: sigpep_I_bact; TIGR02227" /db_xref="CDD:274044" polyA_site 931 /gene="LOC108068636" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgcacttccg ggaccataac agatagcagc gccagaggat taggacatcg ggagatgctc 61 tgataacggg cggatgtgga tcagccaacg ccggaatcgc cgccatgaag atcctctccc 121 gtctgggccg cctgatgcgg tacacggtgg cctatgcggc catcacacac tgcacctttg 181 agtacatagg cgactttgtc ctgtgcaagg gaccctccat ggagcccacc ctctactcgg 241 acaatgtgct gctcaccgag cgcctgtcga agcactggcg aacctaccag ccgggcgaca 301 tcgtcatcgc cgtctcgccc atcaacgccg gccagttcat ctgcaaacgg atcgtggccg 361 tgtccggtga ccaggtgctc acccagaagc cgagccccat tgaggcggag tacagccgaa 421 gtcaggatgg cgccgccgcc ggcaagaagc ccgtgatgac caaggactat gtgccgcgca 481 attacgtttg gctcgagggc gacaacaagg gcaacagctc ggattcgcgc tactatggac 541 ccattccggt gggcctgatc cggagtcggg tgctctgccg catctggccg atttccgagg 601 ccaccgggct gtagattggc tagcccaaga agaagtttta aatcaattgg acctattttg 661 ttttttatag caaattgtag tatatcaatc caatatttta tagatccatt tcgtaccaat 721 ggatgtcata tacttgaaca actgccaata acatatttat tcatatattt atttacactt 781 ccgaaaatgg tctcttattg aattttaaaa tattcttgaa atcatcaaat taaaaaccat 841 gtaaattgca aaattggctt tgcttataca ttttgtagat aaaatacgtt gataaaatat 901 aaaaatacat acttgtgatt atgaatagaa a