Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii armadillo repeat-containing


LOCUS       XM_017158317            2696 bp    mRNA    linear   INV 09-DEC-2024
            protein 2 (LOC108068632), mRNA.
ACCESSION   XM_017158317
VERSION     XM_017158317.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158317.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2696
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2696
                     /gene="LOC108068632"
                     /note="armadillo repeat-containing protein 2; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108068632"
     CDS             1..2580
                     /gene="LOC108068632"
                     /codon_start=1
                     /product="armadillo repeat-containing protein 2"
                     /protein_id="XP_017013806.2"
                     /db_xref="GeneID:108068632"
                     /translation="MSLLLRRRSRSETRPQEIPAEKAKQPEAERQQAKQHQVRHHYPH
                     ASEQNLNKLGLVSSSSGSTGGMGRRKTSAELISEAKLFLGESVGAAPMMATGGARLVS
                     TRRPITPRESGRVLYGKVALAGRPPSAFSMRYLQNEKPSTPRQLPALSGSGPAAPMPT
                     RNGALLCQSSTETLIELLKQHRGLKDCSDETVQHINAILQELYTRVRKQERSFKRGFI
                     LGGLYGLVECSSPRVLLAVARVVLALRVTGSNLTGACKLIFKVARHEQHDALFHEHDV
                     LELLIDGLGHASPLDEPEACIYAYGCIRFLTASSAQERDDALNRNWIGLEGTGELSIP
                     ALSAISSALSPRKLTGQQTLVSRLARHGAVELMILHLQMLNEAGATKRLQGPPLHTLY
                     QLSAAMRALADVSQQQQQQQSLQLQLQLACPHLIRAAEVSMGELEVQANVVRTLSVLS
                     EDSDCCETLHNYAARIGLLLGPSCAGGGQCGERLLAVLSRLGYMLGNILAKHESARIQ
                     YFHNDVAMEYLLNVLEQLNERSPVSVALLDAQIKLIRVVANMSVNPEVGAGLGNVRSL
                     GAVLLQLLSKTSAELAKKKTAEQQELLHATLGALHNLCFYQDKQAVVHPLAEGSLQSL
                     IDDLSASLASVLSNCAASVTKVELSRVLGNLTRNERARRCFCAAGGLPLMVQQLTKQA
                     SGQDYELRTCAIGVLVNLLGDGEQRGPFLQLRGAELLSLLLRGALEQEDWFLANIVCQ
                     ALWNLLIDGQCAANLCQSGNILDEVSDLLADYLDEERLLPGDNDNEEDDPEREQENVE
                     ATETETDPDPDPEAHDALWEDFALVATDLLERIQNNFDRQQQSQTLVVDNEDDNDVFI
                     EEM"
     misc_feature    1687..1809
                     /gene="LOC108068632"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    order(1780..1782,1792..1794,1804..1806,1909..1911,
                     1948..1950,1960..1962,2071..2073,2083..2085,2095..2097)
                     /gene="LOC108068632"
                     /note="putative peptide binding site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:293788"
     misc_feature    1825..1971
                     /gene="LOC108068632"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     misc_feature    1984..2100
                     /gene="LOC108068632"
                     /note="armadillo repeat [structural motif]; Region:
                     armadillo repeat"
                     /db_xref="CDD:293788"
     polyA_site      2696
                     /gene="LOC108068632"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 atgagtttgc ttttgaggcg acgttcacgc agcgagacgc gtcctcagga gattcccgcg
       61 gagaaggcca agcagccgga ggcggagaga cagcaggcga agcagcacca agtgcgccat
      121 cattatccgc atgccagtga gcagaatctg aacaaattgg gcctggtttc tagttctagt
      181 ggctccactg gcggaatggg caggcgcaag acatcggcag agctgataag cgaggccaag
      241 ctgttcctgg gcgaatccgt gggcgccgct cccatgatgg ccaccggtgg agctcgtttg
      301 gtcagcaccc gtcgacccat tacgccccgc gaatccggca gggttttgta cggcaaagtg
      361 gccctcgcag gacgcccacc gagcgctttc tccatgcggt atctgcagaa cgagaaacca
      421 tccacgcccc gccagctgcc ggctttgtct ggctccggac ccgccgcacc catgcccacc
      481 aggaacggag ctctgctctg ccagtccagc actgagaccc tgattgagct gctcaagcag
      541 catcgtggcc taaaggattg cagcgatgag acagtgcagc acataaatgc gatcctccag
      601 gagctctaca cgcgcgtgag aaagcaggag cgcagcttca agcgtggctt catcctgggc
      661 ggactctatg gtttggtgga atgcagttcg ccacgtgttc tcttggccgt ggctcgtgtg
      721 gtcttggccc tccgagtcac gggcagcaac ctcacaggtg cctgcaagct gatcttcaag
      781 gtggccaggc acgagcagca tgatgctctg ttccacgaac acgacgtcct cgagctgctc
      841 atcgatggcc tgggacacgc gtcgcccttg gacgagccgg aggcctgcat ttatgcctac
      901 ggctgcatac gcttcctgac cgccagcagt gcccaggagc gcgacgatgc cctcaaccgc
      961 aattggattg gtctggaggg cactggcgag ctgtctattc ccgccctatc ggccatttcg
     1021 tcggcgcttt ccccgcggaa actgacgggc cagcagacgt tggtttcccg cctggctcgc
     1081 cacggcgccg tggagctgat gatcctgcac ctgcagatgc tgaacgaggc gggggccacc
     1141 aagaggctcc aggggccgcc gcttcacacg ctctatcaac tgtcggccgc catgagagct
     1201 ttggcggatg tttcccaaca gcagcagcag cagcagagcc tgcagctcca gttgcagctg
     1261 gcctgtccgc atctcatccg ggcggccgag gtctccatgg gcgaactgga ggtgcaggcc
     1321 aatgtggtgc gcacgctgag cgttctttcc gaggactccg attgctgtga gacgctgcac
     1381 aactatgcgg ccaggattgg cctgctcctg ggtccttcct gcgccggcgg cgggcagtgc
     1441 ggtgagcgtc tcctggcggt gctcagtcgc ctgggctata tgctgggcaa tatactggcc
     1501 aaacacgaat cggcgcgcat tcagtacttt cacaacgatg tggccatgga gtatctgctg
     1561 aatgtcctgg agcagctcaa cgaacgttcg cccgttagtg tggctctctt ggatgcccaa
     1621 atcaagttga tacgcgtggt ggccaatatg agtgtgaatc ccgaggtggg cgccggtttg
     1681 ggcaatgtcc gttccctggg cgccgttctc ctgcagctgc tgagcaaaac cagcgcagag
     1741 ttggccaaga agaagacggc ggaacaacag gagctgctgc acgccacctt gggagccctg
     1801 cacaatctgt gtttctatca ggacaaacag gcagtggtgc atcctttggc cgagggatcc
     1861 cttcagagcc tcattgacga cctgtccgct tcgttggcca gtgttttaag caactgtgcg
     1921 gcgtcagtga ccaaagtgga gttgtcccgc gtgctgggca atctgacgag gaacgagcga
     1981 gctcgtcgct gcttctgtgc cgccggagga ttgccgctga tggtgcagca actgacgaag
     2041 caggcgtctg gccaggatta cgagctgcgc acctgtgcca ttggggtcct ggtcaatctg
     2101 ctgggcgatg gtgagcagcg aggtcctttt ctgcagctcc gaggggcgga actgctgtcc
     2161 ctgctgctgc gcggagccct ggagcaggag gattggttcc tggccaatat cgtttgccag
     2221 gccctctgga atctcctcat cgacggccag tgtgcggcca atctctgcca gagcggcaat
     2281 atcctcgatg aagtgagcga tttgctggcc gattatctcg atgaggagcg attactgccc
     2341 ggcgataacg ataacgaaga ggacgatccg gagagggaac aggagaatgt ggaggcgacg
     2401 gaaacggaaa cagatccaga tccagatcct gaggcccacg atgctttgtg ggaggatttc
     2461 gccctggtgg ccaccgattt gctggaacgc atccaaaaca actttgatag acagcagcaa
     2521 tcgcagacat tggttgtcga taacgaagac gataacgacg tattcatcga ggaaatgtag
     2581 taacagagtt cgttcgatag tttatagtgt ttctatgtgt ttacctatct attattcgat
     2641 aaatatcttt aaccaaataa tcagagccaa ttaaaaatgt ttgaaaatac tcttga