Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017158315 664 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017158315 VERSION XM_017158315.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017158315.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..664 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..664 /gene="rtv" /note="QVR superfamily protein rtv; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108068631" CDS 94..546 /gene="rtv" /codon_start=1 /product="UPAR/Ly6 domain-containing protein rtv" /protein_id="XP_017013804.2" /db_xref="GeneID:108068631" /translation="MQSTSLFLAVIFLISFVQIDGLLRRCYQCRSRGDLGSCKDPFAF NATDVEQEPGVAAIPCASGWCGKVIEGGGTYAIDDYDLAIQRMCVQRGPDDNMDRCAD TIYNYKKVYMCFCQGDLCNGTSSWSSAPPMILLLMLPLIGGLIKCFRA" misc_feature 160..459 /gene="rtv" /note="extracellular domain (ECD) found in Drosophila melanogaster protein retroactive and similar proteins; Region: TFP_LU_ECD_Rtv; cd23589" /db_xref="CDD:467118" polyA_site 664 /gene="rtv" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tattttattt acggtctgcc ttgatcttaa catttatatt ttttacttta ccaccagttg 61 ttttgtatat agttaatatt taaagtcggg aacatgcaat ccactagcct ttttctggct 121 gtgattttcc ttataagttt tgtccaaatc gatggcctcc tgcgtcgctg ctaccagtgc 181 cgatcccgcg gggatctggg cagctgcaag gacccgttcg ccttcaacgc gacggacgtg 241 gagcaggagc ccggggtggc ggccattccc tgcgccagcg gctggtgcgg caaggtgatc 301 gagggcggcg gcacctatgc catcgacgac tacgacctgg ccatccagcg gatgtgcgtg 361 cagcgcggtc cggacgacaa catggaccgc tgcgcggaca ccatctacaa ctacaagaag 421 gtgtacatgt gcttctgcca gggcgacctg tgcaacggaa cgagcagctg gtccagtgcg 481 cctccgatga tcctcctcct aatgctgcct ttaatcggcg gattgattaa gtgtttccga 541 gcctagactg cttttttggc ctttggcctg caatgtatat acattttata atactcaatc 601 aacacgaaat gcaatacttt caattcgaaa ataaaaacct ttttttgtta atatttaaaa 661 tgta