Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii QVR superfamily protein rtv (rtv),


LOCUS       XM_017158315             664 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017158315
VERSION     XM_017158315.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158315.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..664
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..664
                     /gene="rtv"
                     /note="QVR superfamily protein rtv; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108068631"
     CDS             94..546
                     /gene="rtv"
                     /codon_start=1
                     /product="UPAR/Ly6 domain-containing protein rtv"
                     /protein_id="XP_017013804.2"
                     /db_xref="GeneID:108068631"
                     /translation="MQSTSLFLAVIFLISFVQIDGLLRRCYQCRSRGDLGSCKDPFAF
                     NATDVEQEPGVAAIPCASGWCGKVIEGGGTYAIDDYDLAIQRMCVQRGPDDNMDRCAD
                     TIYNYKKVYMCFCQGDLCNGTSSWSSAPPMILLLMLPLIGGLIKCFRA"
     misc_feature    160..459
                     /gene="rtv"
                     /note="extracellular domain (ECD) found in Drosophila
                     melanogaster protein retroactive and similar proteins;
                     Region: TFP_LU_ECD_Rtv; cd23589"
                     /db_xref="CDD:467118"
     polyA_site      664
                     /gene="rtv"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tattttattt acggtctgcc ttgatcttaa catttatatt ttttacttta ccaccagttg
       61 ttttgtatat agttaatatt taaagtcggg aacatgcaat ccactagcct ttttctggct
      121 gtgattttcc ttataagttt tgtccaaatc gatggcctcc tgcgtcgctg ctaccagtgc
      181 cgatcccgcg gggatctggg cagctgcaag gacccgttcg ccttcaacgc gacggacgtg
      241 gagcaggagc ccggggtggc ggccattccc tgcgccagcg gctggtgcgg caaggtgatc
      301 gagggcggcg gcacctatgc catcgacgac tacgacctgg ccatccagcg gatgtgcgtg
      361 cagcgcggtc cggacgacaa catggaccgc tgcgcggaca ccatctacaa ctacaagaag
      421 gtgtacatgt gcttctgcca gggcgacctg tgcaacggaa cgagcagctg gtccagtgcg
      481 cctccgatga tcctcctcct aatgctgcct ttaatcggcg gattgattaa gtgtttccga
      541 gcctagactg cttttttggc ctttggcctg caatgtatat acattttata atactcaatc
      601 aacacgaaat gcaatacttt caattcgaaa ataaaaacct ttttttgtta atatttaaaa
      661 tgta