Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017158289 723 bp mRNA linear INV 09-DEC-2024 S-II (LOC108068618), mRNA. ACCESSION XM_017158289 VERSION XM_017158289.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017158289.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..723 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..723 /gene="LOC108068618" /note="transcription elongation factor S-II; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108068618" CDS 113..601 /gene="LOC108068618" /codon_start=1 /product="transcription elongation factor S-II" /protein_id="XP_017013778.1" /db_xref="GeneID:108068618" /translation="MSFEVRMKCRELLADVLRIGQLAEGCGDPDDMAAQLEQAIHEEL RGSDIKYKNRIRSRLSNLRDPKNPQLRERFLRGLVTPKQLATMSPEEMASDDLKQMRQ KFVQESINQAQLAKVQGTKTDQFKCDRCHKRNCIQLHTQDGDEPMVTFVMCDECGNRW KN" misc_feature <122..595 /gene="LOC108068618" /note="transcription elongation factor S-II; Region: TFSII; TIGR01385" /db_xref="CDD:273592" ORIGIN 1 cagacatcaa atcaattatt cattcctgta cttttcacta gctcaggaag tgtaacaatt 61 gaaacctgct ttttggtgac taacaaagct ctgtcttttc ccccttgcag cgatgtcctt 121 tgaagtgcgc atgaagtgcc gcgagctgct ggcggatgtc ctccggattg gccagctggc 181 ggaaggatgc ggcgatcccg acgacatggc cgcccagctg gagcaggcca ttcacgagga 241 gctaaggggc tcggacatca agtacaaaaa tcgcatccgt tcgcggctct ccaatctgcg 301 cgacccgaag aatccgcaac tgcgcgaaag gttcctgcgc ggcctggtga ccccgaagca 361 gctggccacc atgtcgcccg aggagatggc cagcgacgac ctcaagcaga tgcgccagaa 421 gttcgtccag gagtcgatca accaggccca gctggccaag gtccagggca ccaagacgga 481 ccagttcaag tgcgatcgct gccacaagcg caactgcatc cagctgcaca cccaggacgg 541 cgacgagccc atggtgacct tcgtcatgtg cgacgagtgc ggcaaccgct ggaagaacta 601 gggaacgaac tggggactct gaataataaa tcccagtaca catggaggaa ctcccttttt 661 taacaaaacc cccacacaag aaatctcaac acttatgctg aataaaatat aaaccttgca 721 tct