Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii transcription elongation factor


LOCUS       XM_017158289             723 bp    mRNA    linear   INV 09-DEC-2024
            S-II (LOC108068618), mRNA.
ACCESSION   XM_017158289
VERSION     XM_017158289.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158289.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..723
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..723
                     /gene="LOC108068618"
                     /note="transcription elongation factor S-II; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108068618"
     CDS             113..601
                     /gene="LOC108068618"
                     /codon_start=1
                     /product="transcription elongation factor S-II"
                     /protein_id="XP_017013778.1"
                     /db_xref="GeneID:108068618"
                     /translation="MSFEVRMKCRELLADVLRIGQLAEGCGDPDDMAAQLEQAIHEEL
                     RGSDIKYKNRIRSRLSNLRDPKNPQLRERFLRGLVTPKQLATMSPEEMASDDLKQMRQ
                     KFVQESINQAQLAKVQGTKTDQFKCDRCHKRNCIQLHTQDGDEPMVTFVMCDECGNRW
                     KN"
     misc_feature    <122..595
                     /gene="LOC108068618"
                     /note="transcription elongation factor S-II; Region:
                     TFSII; TIGR01385"
                     /db_xref="CDD:273592"
ORIGIN      
        1 cagacatcaa atcaattatt cattcctgta cttttcacta gctcaggaag tgtaacaatt
       61 gaaacctgct ttttggtgac taacaaagct ctgtcttttc ccccttgcag cgatgtcctt
      121 tgaagtgcgc atgaagtgcc gcgagctgct ggcggatgtc ctccggattg gccagctggc
      181 ggaaggatgc ggcgatcccg acgacatggc cgcccagctg gagcaggcca ttcacgagga
      241 gctaaggggc tcggacatca agtacaaaaa tcgcatccgt tcgcggctct ccaatctgcg
      301 cgacccgaag aatccgcaac tgcgcgaaag gttcctgcgc ggcctggtga ccccgaagca
      361 gctggccacc atgtcgcccg aggagatggc cagcgacgac ctcaagcaga tgcgccagaa
      421 gttcgtccag gagtcgatca accaggccca gctggccaag gtccagggca ccaagacgga
      481 ccagttcaag tgcgatcgct gccacaagcg caactgcatc cagctgcaca cccaggacgg
      541 cgacgagccc atggtgacct tcgtcatgtg cgacgagtgc ggcaaccgct ggaagaacta
      601 gggaacgaac tggggactct gaataataaa tcccagtaca catggaggaa ctcccttttt
      661 taacaaaacc cccacacaag aaatctcaac acttatgctg aataaaatat aaaccttgca
      721 tct