Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017158286             488 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068617), mRNA.
ACCESSION   XM_017158286
VERSION     XM_017158286.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158286.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..488
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..488
                     /gene="LOC108068617"
                     /note="uncharacterized LOC108068617; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108068617"
     CDS             81..437
                     /gene="LOC108068617"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017013775.2"
                     /db_xref="GeneID:108068617"
                     /translation="MEDNAINEHYIRVMSEMEKEELLSFDEILNLTNASQKVLTNTIK
                     VLARQHFQAKSKPKLVESFQKLSLNSPDNKIVDMEEDVEIISFEDLVILTGAHPLYLE
                     RSLHKIAILSEYIRNV"
     polyA_site      488
                     /gene="LOC108068617"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attgcggtgt caactctaac cttaaatcag acattcaata ttatatcgga gctgtgtaca
       61 aaatataaaa gccgagcata atggaggata acgcaataaa tgagcactat atccgcgtca
      121 tgtcggaaat ggaaaaggag gagctgctga gcttcgacga aatcctcaac ttgaccaacg
      181 cctcgcaaaa ggtgctaacc aacaccatca aggttttggc cagacagcac ttccaagcga
      241 aatcaaagcc gaaacttgta gagagttttc aaaaattgag cctcaacagc ccggacaata
      301 agattgtaga catggaagaa gacgtggaaa tcataagctt cgaggacctg gtgattctca
      361 caggagccca tcctttgtac ctggagcgca gtctgcacaa gatcgccata ctgagcgaat
      421 atatacgcaa tgtgtagtgg accataatgt tctatacaaa tattaaacaa atattcgttt
      481 aaagttga