Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017158286 488 bp mRNA linear INV 09-DEC-2024 (LOC108068617), mRNA. ACCESSION XM_017158286 VERSION XM_017158286.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017158286.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..488 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..488 /gene="LOC108068617" /note="uncharacterized LOC108068617; Derived by automated computational analysis using gene prediction method: Gnomon." /db_xref="GeneID:108068617" CDS 81..437 /gene="LOC108068617" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017013775.2" /db_xref="GeneID:108068617" /translation="MEDNAINEHYIRVMSEMEKEELLSFDEILNLTNASQKVLTNTIK VLARQHFQAKSKPKLVESFQKLSLNSPDNKIVDMEEDVEIISFEDLVILTGAHPLYLE RSLHKIAILSEYIRNV" polyA_site 488 /gene="LOC108068617" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attgcggtgt caactctaac cttaaatcag acattcaata ttatatcgga gctgtgtaca 61 aaatataaaa gccgagcata atggaggata acgcaataaa tgagcactat atccgcgtca 121 tgtcggaaat ggaaaaggag gagctgctga gcttcgacga aatcctcaac ttgaccaacg 181 cctcgcaaaa ggtgctaacc aacaccatca aggttttggc cagacagcac ttccaagcga 241 aatcaaagcc gaaacttgta gagagttttc aaaaattgag cctcaacagc ccggacaata 301 agattgtaga catggaagaa gacgtggaaa tcataagctt cgaggacctg gtgattctca 361 caggagccca tcctttgtac ctggagcgca gtctgcacaa gatcgccata ctgagcgaat 421 atatacgcaa tgtgtagtgg accataatgt tctatacaaa tattaaacaa atattcgttt 481 aaagttga