Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017158285             860 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068616), mRNA.
ACCESSION   XM_017158285
VERSION     XM_017158285.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158285.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..860
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..860
                     /gene="LOC108068616"
                     /note="uncharacterized LOC108068616; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108068616"
     CDS             103..780
                     /gene="LOC108068616"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017013774.3"
                     /db_xref="GeneID:108068616"
                     /translation="MPSKRCRVDKSRLLAEISKRPSIWDTRINFAVRRPKMLLDWPAV
                     GQAMRCCVEECKRLWKGLRGNYRTEVRRRVGGCRWRYFEEMEFMREVFLRPKEKEVAP
                     VLCHSGGLHFEVAEHLFVVLDSMETGLDMDEEMARQLGSENWLWDPKVELALTLGADL
                     PPFPPAAPSMDIPPYPDLNSNDPDLIYVRELVPFVQSLSQQSRQRFRILARDLLGRVM
                     TENQQGE"
     misc_feature    136..378
                     /gene="LOC108068616"
                     /note="subfamily of SANT domain; Region: MADF; smart00595"
                     /db_xref="CDD:214738"
ORIGIN      
        1 cagataagtc acgtcaaaaa acatatgttg agctaaaaaa ataataaact taggaaatat
       61 cgaacaggcg ttccaacttt ttgatctgag aagacacctg tgatgccctc caaacgctgc
      121 agagtggaca agagccgtct cctcgcggag atctccaagc gcccgtcgat ctgggacacc
      181 cgcattaact ttgccgtccg gcgtcccaag atgctcctcg attggccagc ggtgggccag
      241 gcgatgaggt gctgcgtgga ggagtgcaag cgcctgtgga agggtctccg cgggaattat
      301 cgcaccgagg tgcgccgccg cgtgggagga tgccgttggc ggtacttcga ggaaatggag
      361 ttcatgcgcg aggtcttctt gaggccaaag gaaaaggaag tggcgccggt gctctgccac
      421 tctggtggtc tccactttga ggtggcggag catctatttg tggtgctgga cagtatggaa
      481 accggtctgg atatggacga ggagatggcc aggcagttgg gctccgagaa ctggttgtgg
      541 gaccccaagg tggaacttgc cctgaccctg ggggcggatc ttcctccctt tccgcctgca
      601 gcgccatcaa tggatattcc cccatatccg gatttgaatt ccaacgatcc tgacttaatc
      661 tacgtaaggg aactggtgcc cttcgtccaa tccctaagcc agcagtcacg gcagcgtttc
      721 cgcatcctgg caagggatct gcttgggcga gtgatgaccg aaaatcagca gggggaatag
      781 cattggaatc agaagacaca atcatttaac attcgctaaa ttgtacctga aacaactgat
      841 tttataaaac gatttttatt