Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Kruppel-like factor 15 (Klf15),


LOCUS       XM_017158284             918 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017158284
VERSION     XM_017158284.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017158284.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..918
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..918
                     /gene="Klf15"
                     /note="Kruppel-like factor 15; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108068615"
     CDS             1..918
                     /gene="Klf15"
                     /codon_start=1
                     /product="Krueppel-like factor 3"
                     /protein_id="XP_017013773.2"
                     /db_xref="GeneID:108068615"
                     /translation="MDFFATGGFQQLYSDLDEEPLAGGDALLNNAASVVDFECPYAID
                     NMDNNMDNHLDLEESDYYGIITLDSNNNNSSGNNNIHVELPFTEDPSLFIDFSDLTVC
                     PPDLSDWEQRLLDNYVEIPELVDFLPERTPLCTDNCADFLEESNSNLRLAAPPPDLQS
                     PGSGSYPASPADAPAAPPALQLSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLG
                     EKPYVCSWPECVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHER
                     RLLAASRAGRLISDDLYAVRPGRKRKNQL"
     misc_feature    <562..816
                     /gene="Klf15"
                     /note="Putative transcriptional repressor regulating G2/M
                     transition [Transcription / Cell division and chromosome
                     partitioning]; Region: SFP1; COG5189"
                     /db_xref="CDD:227516"
     misc_feature    592..648
                     /gene="Klf15"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    order(601..603,607..609,613..615,619..624,631..636,
                     643..645,691..693,697..699,709..714,721..726,733..735,
                     775..777,781..783,787..789,793..798,805..810,817..819)
                     /gene="Klf15"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:275368"
     misc_feature    670..738
                     /gene="Klf15"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
     misc_feature    712..789
                     /gene="Klf15"
                     /note="Zinc-finger double domain; Region: zf-H2C2_2;
                     pfam13465"
                     /db_xref="CDD:463886"
     misc_feature    760..822
                     /gene="Klf15"
                     /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn
                     finger"
                     /db_xref="CDD:275368"
ORIGIN      
        1 atggacttct ttgcgacagg cggattccag cagctttaca gcgacttgga cgaggagccg
       61 ctggccggcg gcgatgcgct gctcaataat gccgccagtg tcgtggactt tgagtgcccc
      121 tatgccatcg ataacatgga taataacatg gataaccatc tggacttgga ggaatcggat
      181 tactatggca tcatcacgct ggacagcaat aataacaaca gcagtggcaa caacaatatt
      241 cacgtggagc tgccgttcac ggaggatccc tcgttgttca tagacttcag tgatctgacc
      301 gtctgtccgc cggatttgag tgactgggag cagcggctgt tggacaacta tgtggagatt
      361 ccggaactgg tggactttct gcctgagcgg acgcccctgt gcaccgataa ctgtgcggat
      421 tttctggagg agagcaacag taaccttcgg ctggcggcgc caccgcctga tcttcagtcg
      481 cccggcagtg gtagttatcc cgccagtccc gcggatgccc cagccgcccc tcctgccctc
      541 cagttgagcg agaatgccgc cggcgaaagg ggctatctgt gcaccttcgg caactgcgag
      601 aagatctatg ccaagccggc gcacctgaag gcccatctgc ggaggcatct gggcgagaag
      661 ccctatgtct gcagctggcc ggagtgcgtc tggcggttct cccgatccga cgaactggcc
      721 cgccacaagc gctcccactc cggggtgaag ccatacaagt gcgactactg ctccaagtgc
      781 ttcgccaggt cggatcacct caccaagcac cggaaggtcc acgagcggcg actgctggcc
      841 gcctccagag cgggcagact catctccgac gacctctatg ccgtgcgacc gggtcgaaag
      901 cgaaagaacc agctatag