Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017158284 918 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017158284 VERSION XM_017158284.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017158284.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..918 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..918 /gene="Klf15" /note="Kruppel-like factor 15; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108068615" CDS 1..918 /gene="Klf15" /codon_start=1 /product="Krueppel-like factor 3" /protein_id="XP_017013773.2" /db_xref="GeneID:108068615" /translation="MDFFATGGFQQLYSDLDEEPLAGGDALLNNAASVVDFECPYAID NMDNNMDNHLDLEESDYYGIITLDSNNNNSSGNNNIHVELPFTEDPSLFIDFSDLTVC PPDLSDWEQRLLDNYVEIPELVDFLPERTPLCTDNCADFLEESNSNLRLAAPPPDLQS PGSGSYPASPADAPAAPPALQLSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLG EKPYVCSWPECVWRFSRSDELARHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHER RLLAASRAGRLISDDLYAVRPGRKRKNQL" misc_feature <562..816 /gene="Klf15" /note="Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]; Region: SFP1; COG5189" /db_xref="CDD:227516" misc_feature 592..648 /gene="Klf15" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(601..603,607..609,613..615,619..624,631..636, 643..645,691..693,697..699,709..714,721..726,733..735, 775..777,781..783,787..789,793..798,805..810,817..819) /gene="Klf15" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature 670..738 /gene="Klf15" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 712..789 /gene="Klf15" /note="Zinc-finger double domain; Region: zf-H2C2_2; pfam13465" /db_xref="CDD:463886" misc_feature 760..822 /gene="Klf15" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" ORIGIN 1 atggacttct ttgcgacagg cggattccag cagctttaca gcgacttgga cgaggagccg 61 ctggccggcg gcgatgcgct gctcaataat gccgccagtg tcgtggactt tgagtgcccc 121 tatgccatcg ataacatgga taataacatg gataaccatc tggacttgga ggaatcggat 181 tactatggca tcatcacgct ggacagcaat aataacaaca gcagtggcaa caacaatatt 241 cacgtggagc tgccgttcac ggaggatccc tcgttgttca tagacttcag tgatctgacc 301 gtctgtccgc cggatttgag tgactgggag cagcggctgt tggacaacta tgtggagatt 361 ccggaactgg tggactttct gcctgagcgg acgcccctgt gcaccgataa ctgtgcggat 421 tttctggagg agagcaacag taaccttcgg ctggcggcgc caccgcctga tcttcagtcg 481 cccggcagtg gtagttatcc cgccagtccc gcggatgccc cagccgcccc tcctgccctc 541 cagttgagcg agaatgccgc cggcgaaagg ggctatctgt gcaccttcgg caactgcgag 601 aagatctatg ccaagccggc gcacctgaag gcccatctgc ggaggcatct gggcgagaag 661 ccctatgtct gcagctggcc ggagtgcgtc tggcggttct cccgatccga cgaactggcc 721 cgccacaagc gctcccactc cggggtgaag ccatacaagt gcgactactg ctccaagtgc 781 ttcgccaggt cggatcacct caccaagcac cggaaggtcc acgagcggcg actgctggcc 841 gcctccagag cgggcagact catctccgac gacctctatg ccgtgcgacc gggtcgaaag 901 cgaaagaacc agctatag