Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017158283 648 bp mRNA linear INV 09-DEC-2024 (LOC108068613), transcript variant X1, mRNA. ACCESSION XM_017158283 VERSION XM_017158283.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017158283.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..648 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..648 /gene="LOC108068613" /note="uncharacterized LOC108068613; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108068613" CDS 141..542 /gene="LOC108068613" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017013772.1" /db_xref="GeneID:108068613" /translation="MKNNKLDMTNSKKQEKPNNELRKPLKRLNVKVRVMVSPKNASTI RLAKGNHQFPRRRPNTAYNNFLREFKRCNPGALTVEGASLWRKMSLEEKREFRVATTT RLQTDLNIRIAPDQQTYNEQLKDQSDSQTSS" ORIGIN 1 taaataagtt catgacactt tccgggtgat cttggaaaaa taattaggcc taagacccag 61 ttaccctggc ctttactttt ctctagttta ttcattcaga ttcagttaca aaccccggac 121 acactctgta attcaagaca atgaagaaca acaagcttga tatgaccaat tcaaaaaagc 181 aggagaaacc taacaacgag ctgcgtaaac ctctaaagcg cctcaatgtc aaggttcgcg 241 tgatggtgtc accgaaaaat gcatccacta ttcgattggc aaaggggaac caccagtttc 301 caaggcgccg tcccaacacg gcttacaata atttccttcg cgaattcaaa agatgcaacc 361 caggagcctt aacagtggag ggcgcctccc tttggcgcaa aatgagcctt gaggaaaagc 421 gtgaatttcg agtagccacc acaactcgat tgcaaacgga tttgaatatt cgtatagcgc 481 cagatcagca aacttataac gaacaactca aagatcaatc agatagccaa actagctcct 541 gaatgaagga aaagcgttat ttaattaaat atttttcaaa attgttgatg taaaatgtta 601 aatataaaaa aaaatttctt gcacagttgc ataaaagcac aaaataat