Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017158283             648 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068613), transcript variant X1, mRNA.
ACCESSION   XM_017158283
VERSION     XM_017158283.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158283.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..648
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..648
                     /gene="LOC108068613"
                     /note="uncharacterized LOC108068613; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108068613"
     CDS             141..542
                     /gene="LOC108068613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017013772.1"
                     /db_xref="GeneID:108068613"
                     /translation="MKNNKLDMTNSKKQEKPNNELRKPLKRLNVKVRVMVSPKNASTI
                     RLAKGNHQFPRRRPNTAYNNFLREFKRCNPGALTVEGASLWRKMSLEEKREFRVATTT
                     RLQTDLNIRIAPDQQTYNEQLKDQSDSQTSS"
ORIGIN      
        1 taaataagtt catgacactt tccgggtgat cttggaaaaa taattaggcc taagacccag
       61 ttaccctggc ctttactttt ctctagttta ttcattcaga ttcagttaca aaccccggac
      121 acactctgta attcaagaca atgaagaaca acaagcttga tatgaccaat tcaaaaaagc
      181 aggagaaacc taacaacgag ctgcgtaaac ctctaaagcg cctcaatgtc aaggttcgcg
      241 tgatggtgtc accgaaaaat gcatccacta ttcgattggc aaaggggaac caccagtttc
      301 caaggcgccg tcccaacacg gcttacaata atttccttcg cgaattcaaa agatgcaacc
      361 caggagcctt aacagtggag ggcgcctccc tttggcgcaa aatgagcctt gaggaaaagc
      421 gtgaatttcg agtagccacc acaactcgat tgcaaacgga tttgaatatt cgtatagcgc
      481 cagatcagca aacttataac gaacaactca aagatcaatc agatagccaa actagctcct
      541 gaatgaagga aaagcgttat ttaattaaat atttttcaaa attgttgatg taaaatgtta
      601 aatataaaaa aaaatttctt gcacagttgc ataaaagcac aaaataat