Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017158282             611 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068613), transcript variant X3, mRNA.
ACCESSION   XM_017158282
VERSION     XM_017158282.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158282.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..611
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..611
                     /gene="LOC108068613"
                     /note="uncharacterized LOC108068613; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108068613"
     CDS             103..504
                     /gene="LOC108068613"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017013771.1"
                     /db_xref="GeneID:108068613"
                     /translation="MKNNKLDMTNSKKQEKPNNELRKPLKRLNVKVRVMVSPKNASTI
                     RLAKGNHQFPRRRPNTAYNNFLREFKRCNPGALTVEGASLWRKMSLEEKREFRVATTT
                     RLQTDLNIRIAPDQQTYNEQLKDQSDSQTSS"
ORIGIN      
        1 taccctggcc tttacttttc tctagtttat tcattcagat tcagttacaa accccggaca
       61 cactctgtaa ttcaagatcg acatttctac gttgcacaga caatgaagaa caacaagctt
      121 gatatgacca attcaaaaaa gcaggagaaa cctaacaacg agctgcgtaa acctctaaag
      181 cgcctcaatg tcaaggttcg cgtgatggtg tcaccgaaaa atgcatccac tattcgattg
      241 gcaaagggga accaccagtt tccaaggcgc cgtcccaaca cggcttacaa taatttcctt
      301 cgcgaattca aaagatgcaa cccaggagcc ttaacagtgg agggcgcctc cctttggcgc
      361 aaaatgagcc ttgaggaaaa gcgtgaattt cgagtagcca ccacaactcg attgcaaacg
      421 gatttgaata ttcgtatagc gccagatcag caaacttata acgaacaact caaagatcaa
      481 tcagatagcc aaactagctc ctgaatgaag gaaaagcgtt atttaattaa atatttttca
      541 aaattgttga tgtaaaatgt taaatataaa aaaaaatttc ttgcacagtt gcataaaagc
      601 acaaaataat t