Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017158282 611 bp mRNA linear INV 09-DEC-2024 (LOC108068613), transcript variant X3, mRNA. ACCESSION XM_017158282 VERSION XM_017158282.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017158282.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..611 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..611 /gene="LOC108068613" /note="uncharacterized LOC108068613; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108068613" CDS 103..504 /gene="LOC108068613" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017013771.1" /db_xref="GeneID:108068613" /translation="MKNNKLDMTNSKKQEKPNNELRKPLKRLNVKVRVMVSPKNASTI RLAKGNHQFPRRRPNTAYNNFLREFKRCNPGALTVEGASLWRKMSLEEKREFRVATTT RLQTDLNIRIAPDQQTYNEQLKDQSDSQTSS" ORIGIN 1 taccctggcc tttacttttc tctagtttat tcattcagat tcagttacaa accccggaca 61 cactctgtaa ttcaagatcg acatttctac gttgcacaga caatgaagaa caacaagctt 121 gatatgacca attcaaaaaa gcaggagaaa cctaacaacg agctgcgtaa acctctaaag 181 cgcctcaatg tcaaggttcg cgtgatggtg tcaccgaaaa atgcatccac tattcgattg 241 gcaaagggga accaccagtt tccaaggcgc cgtcccaaca cggcttacaa taatttcctt 301 cgcgaattca aaagatgcaa cccaggagcc ttaacagtgg agggcgcctc cctttggcgc 361 aaaatgagcc ttgaggaaaa gcgtgaattt cgagtagcca ccacaactcg attgcaaacg 421 gatttgaata ttcgtatagc gccagatcag caaacttata acgaacaact caaagatcaa 481 tcagatagcc aaactagctc ctgaatgaag gaaaagcgtt atttaattaa atatttttca 541 aaattgttga tgtaaaatgt taaatataaa aaaaaatttc ttgcacagtt gcataaaagc 601 acaaaataat t