Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017158281 599 bp mRNA linear INV 09-DEC-2024 (LOC108068613), transcript variant X2, mRNA. ACCESSION XM_017158281 VERSION XM_017158281.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017158281.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..599 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..599 /gene="LOC108068613" /note="uncharacterized LOC108068613; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108068613" CDS 91..492 /gene="LOC108068613" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017013770.1" /db_xref="GeneID:108068613" /translation="MKNNKLDMTNSKKQEKPNNELRKPLKRLNVKVRVMVSPKNASTI RLAKGNHQFPRRRPNTAYNNFLREFKRCNPGALTVEGASLWRKMSLEEKREFRVATTT RLQTDLNIRIAPDQQTYNEQLKDQSDSQTSS" ORIGIN 1 tctagtttat tcattcagat tcagttacaa accccggaca cactctgtaa ttcaagttat 61 ttagatcgac atttctacgt tgcacagaca atgaagaaca acaagcttga tatgaccaat 121 tcaaaaaagc aggagaaacc taacaacgag ctgcgtaaac ctctaaagcg cctcaatgtc 181 aaggttcgcg tgatggtgtc accgaaaaat gcatccacta ttcgattggc aaaggggaac 241 caccagtttc caaggcgccg tcccaacacg gcttacaata atttccttcg cgaattcaaa 301 agatgcaacc caggagcctt aacagtggag ggcgcctccc tttggcgcaa aatgagcctt 361 gaggaaaagc gtgaatttcg agtagccacc acaactcgat tgcaaacgga tttgaatatt 421 cgtatagcgc cagatcagca aacttataac gaacaactca aagatcaatc agatagccaa 481 actagctcct gaatgaagga aaagcgttat ttaattaaat atttttcaaa attgttgatg 541 taaaatgtta aatataaaaa aaaatttctt gcacagttgc ataaaagcac aaaataatt