PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017158265             805 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068599), mRNA.
ACCESSION   XM_017158265
VERSION     XM_017158265.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017158265.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..805
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..805
                     /gene="LOC108068599"
                     /note="uncharacterized LOC108068599; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108068599"
     CDS             67..753
                     /gene="LOC108068599"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017013754.2"
                     /db_xref="GeneID:108068599"
                     /translation="MAATCEESQPAICPVADCRALVTHTHLLRHMISEHLDTRARTLP
                     FQLRLREVASGQQTLLMLTYRQLAVDHDQCLAVLNWSCDSPFDLMEPQLDLPPCHQAL
                     TFHLPVLVMVCRTTWKALLKQDDDKGVSRDLTSEWGTVYLLWLVSPFTRRAIYANLAV
                     LNSRLQCIVRRNRRRIRNFASRMPISQFINGLDPFFVSLNEDQLDELCDGGGEKASVF
                     LEVTIEGEGQ"
     misc_feature    97..726
                     /gene="LOC108068599"
                     /note="Domain of unknown function (DUF4729); Region:
                     DUF4729; pfam15866"
                     /db_xref="CDD:434981"
     polyA_site      805
                     /gene="LOC108068599"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgttttccc tcaatatttg ttgctatttt tccatatatg tattaaatat tccagataaa
       61 tgaaatatgg ctgcgacgtg tgaggaaagt cagccggcca tttgtcccgt ggcagattgc
      121 cgggctctgg tgacgcacac ccacttgctg cggcacatga tcagcgagca tttggatacg
      181 cgggcacgaa ccctgccctt tcagctgcgc ctgcgcgaag tggccagtgg ccagcagacc
      241 ctgctgatgc tcacctaccg ccagctggcc gtcgatcatg accagtgcct ggcggtgctc
      301 aactggagct gcgactcgcc attcgacctc atggaaccgc agctggacct gccgccctgc
      361 caccaggcgc tgaccttcca cctgcccgtt ctggtgatgg tctgtcggac cacctggaag
      421 gctctcctga agcaagatga cgacaagggg gtctccaggg acctaacctc cgagtggggc
      481 accgtctatc tgctgtggct cgtctctccg ttcacccggc gagccatcta tgcgaatctc
      541 gccgtcttga acagccggct gcagtgcatc gtgcggcgga atcgccgacg aatccggaac
      601 ttcgccagcc ggatgcccat tagccagttc atcaacggac tcgatccgtt ctttgtcagc
      661 ctcaacgagg atcagctgga cgagctgtgc gacggcggtg gcgagaaggc ctccgtcttc
      721 ctggaggtca ccatcgaggg ggaggggcag tagctcaagt atttcatttt aataaaatta
      781 tcacagtgat tttgtagatt tgaaa