Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Ferritin 3 heavy chain homologue


LOCUS       XM_017157767             743 bp    mRNA    linear   INV 09-DEC-2024
            (Fer3HCH), mRNA.
ACCESSION   XM_017157767
VERSION     XM_017157767.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157767.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..743
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..743
                     /gene="Fer3HCH"
                     /note="Ferritin 3 heavy chain homologue; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 3 Proteins"
                     /db_xref="GeneID:108068299"
     CDS             99..659
                     /gene="Fer3HCH"
                     /codon_start=1
                     /product="soma ferritin"
                     /protein_id="XP_017013256.2"
                     /db_xref="GeneID:108068299"
                     /translation="MALCSRNIGRHMCMLMRQNFAKSCEKKLNDQINMELKACHQYLA
                     MAYHFDRSDISSPGLHGFFLKSSAEEREHAEKIMKYMNKRGGLIVLSSVPEPQPCFAS
                     SLDALKVALKMELEVNRHLLDLHSLAGKESDPNLCDFIEANFLQEQVDGQKILADYIC
                     QLEKAQTDVGDYLFDKYMGSGMHSGK"
     misc_feature    168..629
                     /gene="Fer3HCH"
                     /note="eukaryotic ferritins; Region: Euk_Ferritin;
                     cd01056"
                     /db_xref="CDD:153114"
     misc_feature    order(201..203,222..224,303..308,315..317,438..440,
                     540..542)
                     /gene="Fer3HCH"
                     /note="ferroxidase diiron center [ion binding]; other
                     site"
                     /db_xref="CDD:153114"
     misc_feature    order(291..293,300..305,312..314)
                     /gene="Fer3HCH"
                     /note="ferrihydrite nucleation center [active]"
                     /db_xref="CDD:153114"
     misc_feature    order(471..473,510..512,519..521)
                     /gene="Fer3HCH"
                     /note="iron ion channel [active]"
                     /db_xref="CDD:153114"
     polyA_site      743
                     /gene="Fer3HCH"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tggcattcgg acatactgtt tgtgttttgg ctttcaattc aaatcgttgg ggtttctaaa
       61 tttccgaaaa acaaaaaaag taaatatatt gaaaagacat ggcgttgtgc tcccgcaaca
      121 ttgggcgcca catgtgcatg ctgatgcgtc agaacttcgc caaaagttgc gagaagaagc
      181 tgaacgacca gatcaacatg gagttgaagg cctgccacca gtacctggcc atggcctacc
      241 atttcgatcg ttcggatatc agttccccgg gactgcatgg attttttctc aagtcgagcg
      301 ccgaggagcg ggagcacgcg gagaaaatca tgaagtacat gaacaagcgg ggcggtctca
      361 tcgttttgag cagtgtacca gagccgcagc cctgtttcgc cagcagcctg gatgccctga
      421 aggtggctct gaaaatggaa ctggaggtca accggcatct gctggatctg cactcgctgg
      481 ccggaaagga atcggatccc aatctgtgcg acttcatcga ggcgaacttc ctgcaggagc
      541 aggtcgacgg ccagaaaatc ctggccgact acatctgcca attggaaaag gcccagacgg
      601 atgtgggtga ctatctgttc gacaagtaca tgggctccgg catgcattcc ggcaagtgaa
      661 gcactcgaaa tggaccacta aaatccgcat tttctaattt tccccatgtg tactgaataa
      721 agattcgttg ccccttcgaa taa