Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157767 743 bp mRNA linear INV 09-DEC-2024 (Fer3HCH), mRNA. ACCESSION XM_017157767 VERSION XM_017157767.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157767.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..743 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..743 /gene="Fer3HCH" /note="Ferritin 3 heavy chain homologue; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108068299" CDS 99..659 /gene="Fer3HCH" /codon_start=1 /product="soma ferritin" /protein_id="XP_017013256.2" /db_xref="GeneID:108068299" /translation="MALCSRNIGRHMCMLMRQNFAKSCEKKLNDQINMELKACHQYLA MAYHFDRSDISSPGLHGFFLKSSAEEREHAEKIMKYMNKRGGLIVLSSVPEPQPCFAS SLDALKVALKMELEVNRHLLDLHSLAGKESDPNLCDFIEANFLQEQVDGQKILADYIC QLEKAQTDVGDYLFDKYMGSGMHSGK" misc_feature 168..629 /gene="Fer3HCH" /note="eukaryotic ferritins; Region: Euk_Ferritin; cd01056" /db_xref="CDD:153114" misc_feature order(201..203,222..224,303..308,315..317,438..440, 540..542) /gene="Fer3HCH" /note="ferroxidase diiron center [ion binding]; other site" /db_xref="CDD:153114" misc_feature order(291..293,300..305,312..314) /gene="Fer3HCH" /note="ferrihydrite nucleation center [active]" /db_xref="CDD:153114" misc_feature order(471..473,510..512,519..521) /gene="Fer3HCH" /note="iron ion channel [active]" /db_xref="CDD:153114" polyA_site 743 /gene="Fer3HCH" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tggcattcgg acatactgtt tgtgttttgg ctttcaattc aaatcgttgg ggtttctaaa 61 tttccgaaaa acaaaaaaag taaatatatt gaaaagacat ggcgttgtgc tcccgcaaca 121 ttgggcgcca catgtgcatg ctgatgcgtc agaacttcgc caaaagttgc gagaagaagc 181 tgaacgacca gatcaacatg gagttgaagg cctgccacca gtacctggcc atggcctacc 241 atttcgatcg ttcggatatc agttccccgg gactgcatgg attttttctc aagtcgagcg 301 ccgaggagcg ggagcacgcg gagaaaatca tgaagtacat gaacaagcgg ggcggtctca 361 tcgttttgag cagtgtacca gagccgcagc cctgtttcgc cagcagcctg gatgccctga 421 aggtggctct gaaaatggaa ctggaggtca accggcatct gctggatctg cactcgctgg 481 ccggaaagga atcggatccc aatctgtgcg acttcatcga ggcgaacttc ctgcaggagc 541 aggtcgacgg ccagaaaatc ctggccgact acatctgcca attggaaaag gcccagacgg 601 atgtgggtga ctatctgttc gacaagtaca tgggctccgg catgcattcc ggcaagtgaa 661 gcactcgaaa tggaccacta aaatccgcat tttctaattt tccccatgtg tactgaataa 721 agattcgttg ccccttcgaa taa