Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii probable alpha-aspartyl


LOCUS       XM_017157756             887 bp    mRNA    linear   INV 09-DEC-2024
            dipeptidase (LOC108068288), mRNA.
ACCESSION   XM_017157756
VERSION     XM_017157756.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157756.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..887
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..887
                     /gene="LOC108068288"
                     /note="probable alpha-aspartyl dipeptidase; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108068288"
     CDS             42..764
                     /gene="LOC108068288"
                     /codon_start=1
                     /product="probable alpha-aspartyl dipeptidase"
                     /protein_id="XP_017013245.2"
                     /db_xref="GeneID:108068288"
                     /translation="MGGARNLLLLSSSRLYGYGYLEHARGQLEDLFKSANVKTVLFVP
                     YALRDHDKYTATVRDALEPWGYQVEGLHTKQDREEALKEAQAIFVGGGNTFVLLRTLY
                     ELKLIDPIRELVLRRGLPYVGSSAGTNVATRSIHTTNDMPVAYPPTFEALALVPFNIN
                     PHYLDPEAGSHHKGETRDERIEEFVAYHRLPVLGLREGTSVRVEGQKATLLGDRNAKL
                     FKADGGAEELTPQADLSFLLHK"
     misc_feature    87..755
                     /gene="LOC108068288"
                     /note="dipeptidase PepE; Region: PRK05282"
                     /db_xref="CDD:179990"
     misc_feature    order(315..317,414..416,459..461,525..527,570..572,
                     630..632)
                     /gene="LOC108068288"
                     /note="active site pocket [active]"
                     /db_xref="CDD:153240"
     misc_feature    order(315..317,417..419)
                     /gene="LOC108068288"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:153240"
     misc_feature    order(414..416,525..527,630..632)
                     /gene="LOC108068288"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:153240"
     misc_feature    414..416
                     /gene="LOC108068288"
                     /note="active site nucleophile [active]"
                     /db_xref="CDD:153240"
     polyA_site      887
                     /gene="LOC108068288"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctgggtgaac cattcaatcc gacgattaga ttgcttgtga aatgggcggt gcacggaacc
       61 ttttgttgct ctcctcgtcg cgtttgtacg gctatggata tttggagcac gcgcgtggcc
      121 agctggagga tctcttcaag agtgccaacg tgaagacggt gctctttgtg ccctacgctc
      181 tgcgggatca cgacaagtac acggccaccg tgcgggatgc cctggagccg tggggctacc
      241 aagtggaggg gctgcacacg aaacaggatc gagaggaggc tctgaaggag gcgcaggcca
      301 tcttcgtggg cggcggcaac accttcgtcc tgctgcgcac cctctacgag ctgaagctga
      361 tcgatcccat ccgggaactg gtcctccggc gcggactgcc ctatgtgggc agcagtgcgg
      421 gcaccaatgt ggccacccgg tccatccaca ccaccaacga catgccggtg gcctatccgc
      481 cgaccttcga ggccctggcc ctcgtgccct tcaacatcaa tccgcactat ctggatccgg
      541 aggcgggcag ccatcacaag ggcgagacgc gggacgagcg gatcgaggag ttcgtggcct
      601 accaccgtct tcccgtcctg ggtcttcgcg agggcaccag tgtccgggtt gagggccaga
      661 aggccacgct cctcggcgat cgcaatgcca agctcttcaa ggctgatggc ggcgccgaag
      721 aactaactcc ccaagcggat ctcagcttcc tgctgcacaa ataagaataa atccaaccca
      781 aaacaatcca gttgaagaaa aaagaaaaca tttaaattta ttgtacatat gcacatacat
      841 aatttgtatt attctgcaat aacaacaatt cctacacgta aacagta