Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157756 887 bp mRNA linear INV 09-DEC-2024 dipeptidase (LOC108068288), mRNA. ACCESSION XM_017157756 VERSION XM_017157756.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157756.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..887 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..887 /gene="LOC108068288" /note="probable alpha-aspartyl dipeptidase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108068288" CDS 42..764 /gene="LOC108068288" /codon_start=1 /product="probable alpha-aspartyl dipeptidase" /protein_id="XP_017013245.2" /db_xref="GeneID:108068288" /translation="MGGARNLLLLSSSRLYGYGYLEHARGQLEDLFKSANVKTVLFVP YALRDHDKYTATVRDALEPWGYQVEGLHTKQDREEALKEAQAIFVGGGNTFVLLRTLY ELKLIDPIRELVLRRGLPYVGSSAGTNVATRSIHTTNDMPVAYPPTFEALALVPFNIN PHYLDPEAGSHHKGETRDERIEEFVAYHRLPVLGLREGTSVRVEGQKATLLGDRNAKL FKADGGAEELTPQADLSFLLHK" misc_feature 87..755 /gene="LOC108068288" /note="dipeptidase PepE; Region: PRK05282" /db_xref="CDD:179990" misc_feature order(315..317,414..416,459..461,525..527,570..572, 630..632) /gene="LOC108068288" /note="active site pocket [active]" /db_xref="CDD:153240" misc_feature order(315..317,417..419) /gene="LOC108068288" /note="oxyanion hole [active]" /db_xref="CDD:153240" misc_feature order(414..416,525..527,630..632) /gene="LOC108068288" /note="catalytic triad [active]" /db_xref="CDD:153240" misc_feature 414..416 /gene="LOC108068288" /note="active site nucleophile [active]" /db_xref="CDD:153240" polyA_site 887 /gene="LOC108068288" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctgggtgaac cattcaatcc gacgattaga ttgcttgtga aatgggcggt gcacggaacc 61 ttttgttgct ctcctcgtcg cgtttgtacg gctatggata tttggagcac gcgcgtggcc 121 agctggagga tctcttcaag agtgccaacg tgaagacggt gctctttgtg ccctacgctc 181 tgcgggatca cgacaagtac acggccaccg tgcgggatgc cctggagccg tggggctacc 241 aagtggaggg gctgcacacg aaacaggatc gagaggaggc tctgaaggag gcgcaggcca 301 tcttcgtggg cggcggcaac accttcgtcc tgctgcgcac cctctacgag ctgaagctga 361 tcgatcccat ccgggaactg gtcctccggc gcggactgcc ctatgtgggc agcagtgcgg 421 gcaccaatgt ggccacccgg tccatccaca ccaccaacga catgccggtg gcctatccgc 481 cgaccttcga ggccctggcc ctcgtgccct tcaacatcaa tccgcactat ctggatccgg 541 aggcgggcag ccatcacaag ggcgagacgc gggacgagcg gatcgaggag ttcgtggcct 601 accaccgtct tcccgtcctg ggtcttcgcg agggcaccag tgtccgggtt gagggccaga 661 aggccacgct cctcggcgat cgcaatgcca agctcttcaa ggctgatggc ggcgccgaag 721 aactaactcc ccaagcggat ctcagcttcc tgctgcacaa ataagaataa atccaaccca 781 aaacaatcca gttgaagaaa aaagaaaaca tttaaattta ttgtacatat gcacatacat 841 aatttgtatt attctgcaat aacaacaatt cctacacgta aacagta