Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157569 648 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017157569 VERSION XM_017157569.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017157569.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..648 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..648 /gene="nullo" /note="nullo; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108068155" CDS 1..648 /gene="nullo" /codon_start=1 /product="protein nullo" /protein_id="XP_017013058.2" /db_xref="GeneID:108068155" /translation="MGSTQSAEKVKSVEDSTSQGNPGIFCTPLPGFISKIQRILVRKL SISARKQKRLSRRSKQTLRPMPRCSSFGSSGTLLTTPGKKSVSTLADRRYAQWKCSFE HLAQKQQRLHDISEAFTVQTTPRGFPSHTDPKRCLLQEESPIPESPLFDMVGGQKIRR RLSLRNHATTLKRSSARQKAEQAKIDEQFQRDLRDLEEYYGGFHFAQCRERLVKI" ORIGIN 1 atgggcagca ctcagtccgc tgaaaaggtg aagagcgtcg aggactcgac cagccaggga 61 aatcccggca ttttctgcac acctctcccc ggtttcataa gcaaaatcca aagaattctc 121 gtccgcaagc tgagcatttc ggccaggaaa caaaagcgac tgagcaggcg gtccaagcaa 181 acccttcgtc ccatgccccg ctgctcatcc tttggctcca gcggcactct gctgacgacg 241 cccggcaaga aatcggtttc cactctggcc gatcgtcgct atgcccaatg gaagtgcagc 301 ttcgagcatt tggcccagaa gcagcagcga ctccacgaca tcagcgaggc cttcacggtg 361 caaactactc cgcggggctt cccctcgcac acggatccca agaggtgtct gctccaggag 421 gagtcgccca ttccggaatc cccgctcttc gacatggtcg gtggccagaa gatccgtcgc 481 cgtttgagtc tgcgcaacca cgccaccact ctgaaacgct cgtcggcccg ccagaaggcc 541 gaacaggcca agatcgacga acagttccag cgggatctcc gcgatctgga ggagtactac 601 ggcggcttcc acttcgccca gtgccgcgag cgattggtca agatctag