PREDICTED: Drosophila takahashii uncharacterized protein

LOCUS       XM_017157566             642 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068152), mRNA.
ACCESSION   XM_017157566
VERSION     XM_017157566.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157566.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..642
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..642
                     /gene="LOC108068152"
                     /note="uncharacterized LOC108068152; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108068152"
     CDS             4..642
                     /gene="LOC108068152"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017013055.3"
                     /db_xref="GeneID:108068152"
                     /translation="MSSYRKLLPIGYRRYFVNNKRFSNMCEVVASPADQRNVEVKARI
                     PGGVEGFGERLILARTLGGGQEAELIEQRDVFFESPRGGRLKLRYLKAPARSQLVYYD
                     RPDVAGPKLSKFNKTEVDEPEVLEKILRQSNGVLGVLAKRRHLFLVGQTRIHLDEVQD
                     LGHFMELEVCLRPEQSLQEGQSIAEKLSQELGIQEQDLMTGSYFDALRKVNQ"
     misc_feature    112..612
                     /gene="LOC108068152"
                     /note="Adenylyl cyclase (AC) class IV-like, a subgroup of
                     the CYTH-like superfamily; Region: CYTH-like_AC_IV-like;
                     cd07890"
                     /db_xref="CDD:143628"
     misc_feature    order(112..114,118..120,124..126,220..222,226..234,
                     259..261,265..267,271..273,307..309,343..345,424..426,
                     430..432,469..471,499..501,505..507,601..603)
                     /gene="LOC108068152"
                     /note="putative active site [active]"
                     /db_xref="CDD:143628"
     misc_feature    order(112..114,118..120,499..501,505..507)
                     /gene="LOC108068152"
                     /note="putative metal binding residues [ion binding];
                     other site"
                     /db_xref="CDD:143628"
     misc_feature    order(112..114,118..120,124..126)
                     /gene="LOC108068152"
                     /note="signature motif [active]"
                     /db_xref="CDD:143628"
     misc_feature    order(118..120,124..126,229..231,259..261,271..273,
                     307..309,343..345,430..432,499..501)
                     /gene="LOC108068152"
                     /note="putative triphosphate binding site [ion binding];
                     other site"
                     /db_xref="CDD:143628"
     misc_feature    order(250..252,256..258,298..300,304..306,310..315,
                     340..342,346..360,364..366,373..378,382..390,394..399)
                     /gene="LOC108068152"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143628"
ORIGIN      
        1 gtgatgtcct cctatcgcaa gctccttcct atcggttatc gccgctattt tgttaacaac
       61 aaaagattta gcaacatgtg cgaagtggtg gcttctccgg cggatcagcg caacgtggag
      121 gtgaaggccc gcattccggg cggcgtcgag ggcttcgggg agcgcctgat cctggccaga
      181 acgctgggcg gcggccagga ggcggagttg atcgagcagc gggacgtgtt ctttgaatct
      241 ccgcgcggag gtcgccttaa attgcgctac ctaaaggctc cggcgcgctc ccaactggtc
      301 tactacgatc gtccggatgt ggcgggtccc aagctctcca aattcaacaa aacggaggtg
      361 gatgagccgg aggtgctcga gaagatcctc cgccagtcga acggagtcct cggtgtcctc
      421 gccaaacggc ggcatctgtt ccttgtgggc cagacacgca tccacctgga cgaggtgcag
      481 gatctgggcc acttcatgga gctggaggtg tgcctgcgac cggaacagag cctccaggag
      541 ggccagagca tcgccgagaa gctgtcccag gagctgggca tccaggagca ggacctcatg
      601 accggctcct acttcgatgc cctgcgaaag gtcaatcaat ag