Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157562 518 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017157562 VERSION XM_017157562.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157562.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..518 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..518 /gene="sloth1" /note="sloth 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108068147" CDS 220..462 /gene="sloth1" /codon_start=1 /product="ubiquinol-cytochrome c reductase complex assembly factor 5" /protein_id="XP_017013051.1" /db_xref="GeneID:108068147" /translation="MSSAYSGSVRRLLDSWPGKRRFGVYRFLPLFFLLGAGLEFSMIK WTVGETNFYRTFKRRQAKNYVEEQQHLQARNAGSSN" misc_feature 232..429 /gene="sloth1" /note="Uncharacterized protein family UPF0640; Region: UPF0640; pfam15114" /db_xref="CDD:464511" ORIGIN 1 agctgactgc tgaggaccga atggaattcg aaacgcgagg caactggagt tgctttggat 61 ttcagacaaa taacaaataa caaggcgaca aactaaaggt ttctgtttga aacctcttcg 121 aggagcaacg cacacatgtg agccaggcat cccacacaca cggcacctct gaatttcgcc 181 caaaaaagag ggcggcaagc acacggaatt acataacaca tgagttcggc gtacagcggc 241 tccgtgcgtc gcctgctgga cagttggccc ggaaagaggc gcttcggcgt gtaccgcttc 301 ctgccgctct tcttcctgct gggcgccggc ctggagttct ccatgatcaa gtggacggtg 361 ggcgagacga atttctatcg cactttcaag cgtcgccagg ccaagaacta cgtggaggag 421 cagcagcatc tgcaggcgcg caacgcaggc agctcaaact agttaaaaac atgcccgccg 481 gcgtctcgtg gggccagtac atgaagttcc tgggctgc