Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii sloth 1 (sloth1), mRNA.


LOCUS       XM_017157562             518 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017157562
VERSION     XM_017157562.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157562.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..518
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..518
                     /gene="sloth1"
                     /note="sloth 1; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 3 Proteins"
                     /db_xref="GeneID:108068147"
     CDS             220..462
                     /gene="sloth1"
                     /codon_start=1
                     /product="ubiquinol-cytochrome c reductase complex
                     assembly factor 5"
                     /protein_id="XP_017013051.1"
                     /db_xref="GeneID:108068147"
                     /translation="MSSAYSGSVRRLLDSWPGKRRFGVYRFLPLFFLLGAGLEFSMIK
                     WTVGETNFYRTFKRRQAKNYVEEQQHLQARNAGSSN"
     misc_feature    232..429
                     /gene="sloth1"
                     /note="Uncharacterized protein family UPF0640; Region:
                     UPF0640; pfam15114"
                     /db_xref="CDD:464511"
ORIGIN      
        1 agctgactgc tgaggaccga atggaattcg aaacgcgagg caactggagt tgctttggat
       61 ttcagacaaa taacaaataa caaggcgaca aactaaaggt ttctgtttga aacctcttcg
      121 aggagcaacg cacacatgtg agccaggcat cccacacaca cggcacctct gaatttcgcc
      181 caaaaaagag ggcggcaagc acacggaatt acataacaca tgagttcggc gtacagcggc
      241 tccgtgcgtc gcctgctgga cagttggccc ggaaagaggc gcttcggcgt gtaccgcttc
      301 ctgccgctct tcttcctgct gggcgccggc ctggagttct ccatgatcaa gtggacggtg
      361 ggcgagacga atttctatcg cactttcaag cgtcgccagg ccaagaacta cgtggaggag
      421 cagcagcatc tgcaggcgcg caacgcaggc agctcaaact agttaaaaac atgcccgccg
      481 gcgtctcgtg gggccagtac atgaagttcc tgggctgc