Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157547 693 bp mRNA linear INV 09-DEC-2024 anchored membrane protein boudin (bou), mRNA. ACCESSION XM_017157547 VERSION XM_017157547.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157547.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..693 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..693 /gene="bou" /note="glycosylphosphatidylinositol anchored membrane protein boudin; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108068135" CDS 92..532 /gene="bou" /codon_start=1 /product="UPAR/Ly6 domain-containing protein bou" /protein_id="XP_017013036.1" /db_xref="GeneID:108068135" /translation="MWPPNHAHLALGLLLCLLMGLQMVTVSGIECYVCDTSDTEHPFQ CGEWFERYDEPDIQPQNCSSVHGAQFCVKHVGRFEGGIGAKRFCSSKDMGNYCDYVRN KGDRMDYRSCIYTCDTDGCNAAGRLELEWGVAAALLTLTWLLRR" misc_feature 176..463 /gene="bou" /note="extracellular domain (ECD) found in Drosophila melanogaster protein boudin and similar proteins; Region: TFP_LU_ECD_Bou; cd23590" /db_xref="CDD:467119" polyA_site 693 /gene="bou" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gcgtttcagt tccagttcaa acttggcatt tgctgacgac gctgactgtc cgactgtttt 61 catccaaagt ctctagacct gtgacgcaat catgtggcct ccgaaccacg cccacctggc 121 cctcggcctc ctcctttgcc tgctgatggg cctgcagatg gtaacggtat cggggatcga 181 gtgctacgtc tgcgacacga gcgacacgga gcatccgttc cagtgcggcg agtggttcga 241 gcggtacgac gagccggaca tccagcccca aaactgttcc agcgtccatg gcgcccagtt 301 ctgcgtgaag cacgtgggcc gcttcgaggg cggaatcggg gcgaagaggt tctgcagctc 361 gaaggacatg ggcaactact gtgactacgt gaggaacaag ggcgatcgca tggactatcg 421 cagctgcatt tacacttgcg atacggacgg ttgcaatgcc gctggaaggc tggaactgga 481 atggggcgtg gcagcggctc tgctcactct cacctggctc ttgcggagat agagcgcggg 541 cgggcgagag cgagagggag ggagggagat cacttttttt ttattaattg taggttgtaa 601 caaagtaact gacacacaca ctctgtagtg tagagaaaaa caaaaacaca aaaacacaaa 661 accaaaaata tataaacaaa aaaaaaaaga aaa