Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii glycosylphosphatidylinositol


LOCUS       XM_017157547             693 bp    mRNA    linear   INV 09-DEC-2024
            anchored membrane protein boudin (bou), mRNA.
ACCESSION   XM_017157547
VERSION     XM_017157547.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157547.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..693
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..693
                     /gene="bou"
                     /note="glycosylphosphatidylinositol anchored membrane
                     protein boudin; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108068135"
     CDS             92..532
                     /gene="bou"
                     /codon_start=1
                     /product="UPAR/Ly6 domain-containing protein bou"
                     /protein_id="XP_017013036.1"
                     /db_xref="GeneID:108068135"
                     /translation="MWPPNHAHLALGLLLCLLMGLQMVTVSGIECYVCDTSDTEHPFQ
                     CGEWFERYDEPDIQPQNCSSVHGAQFCVKHVGRFEGGIGAKRFCSSKDMGNYCDYVRN
                     KGDRMDYRSCIYTCDTDGCNAAGRLELEWGVAAALLTLTWLLRR"
     misc_feature    176..463
                     /gene="bou"
                     /note="extracellular domain (ECD) found in Drosophila
                     melanogaster protein boudin and similar proteins; Region:
                     TFP_LU_ECD_Bou; cd23590"
                     /db_xref="CDD:467119"
     polyA_site      693
                     /gene="bou"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gcgtttcagt tccagttcaa acttggcatt tgctgacgac gctgactgtc cgactgtttt
       61 catccaaagt ctctagacct gtgacgcaat catgtggcct ccgaaccacg cccacctggc
      121 cctcggcctc ctcctttgcc tgctgatggg cctgcagatg gtaacggtat cggggatcga
      181 gtgctacgtc tgcgacacga gcgacacgga gcatccgttc cagtgcggcg agtggttcga
      241 gcggtacgac gagccggaca tccagcccca aaactgttcc agcgtccatg gcgcccagtt
      301 ctgcgtgaag cacgtgggcc gcttcgaggg cggaatcggg gcgaagaggt tctgcagctc
      361 gaaggacatg ggcaactact gtgactacgt gaggaacaag ggcgatcgca tggactatcg
      421 cagctgcatt tacacttgcg atacggacgg ttgcaatgcc gctggaaggc tggaactgga
      481 atggggcgtg gcagcggctc tgctcactct cacctggctc ttgcggagat agagcgcggg
      541 cgggcgagag cgagagggag ggagggagat cacttttttt ttattaattg taggttgtaa
      601 caaagtaact gacacacaca ctctgtagtg tagagaaaaa caaaaacaca aaaacacaaa
      661 accaaaaata tataaacaaa aaaaaaaaga aaa