Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157538 1017 bp mRNA linear INV 09-DEC-2024 protein 57 (LOC108068131), mRNA. ACCESSION XM_017157538 VERSION XM_017157538.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017157538.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1017 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1017 /gene="LOC108068131" /note="leucine-rich repeat-containing protein 57; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108068131" CDS 151..867 /gene="LOC108068131" /codon_start=1 /product="leucine-rich repeat-containing protein 57" /protein_id="XP_017013027.1" /db_xref="GeneID:108068131" /translation="MGNKQIKQHLETAQKTGILKISLQRLQEFPPQLKAYPNVLKTLD LSENRFERVPDELGKLTLLKHLNLSGNRLAELNEVVGELAKLEVLLLMDNLLTRLPKT LANCSHLKTVNLSNNQLKEFPAMLCGLKQLDVLDLSRNRITEVPAEVGGLYVTELNLN QNQISALAEDVAECPKLKTLRLEENCLQAAAFTPRILKESKICNLAVDGNLFNSKQFT DLDGYDVYMERYTAVRKKMF" misc_feature <268..>810 /gene="LOC108068131" /note="Leucine-rich repeat (LRR) protein [Transcription]; Region: LRR; COG4886" /db_xref="CDD:443914" misc_feature 268..336 /gene="LOC108068131" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 337..405 /gene="LOC108068131" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 406..474 /gene="LOC108068131" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 475..543 /gene="LOC108068131" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 544..612 /gene="LOC108068131" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" misc_feature 613..678 /gene="LOC108068131" /note="leucine-rich repeat [structural motif]; Region: leucine-rich repeat" /db_xref="CDD:275380" polyA_site 1017 /gene="LOC108068131" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ctaaccagag agcagccacg gtcatactgc taaagaaaac aagtaaatag ttttaattat 61 ttactaaaag tgctgttaaa cgcgagagga gcgaggatat ccgaccaagc ccacctggat 121 tagtcatcgg caaccccacc cacccggaaa atgggcaaca agcagataaa acagcacctg 181 gagacggcgc agaagacggg catcctgaag atctcgctgc agcgcctgca ggagttcccg 241 ccgcagctga aggcctaccc gaatgtgctg aagaccctcg atctcagcga gaatcgcttc 301 gagcgcgtgc ccgacgaact gggcaagctg acgctgctga agcacctcaa tctcagcggc 361 aaccggctgg ccgagctcaa cgaggtggtg ggcgagctgg ccaagctgga ggtgctcctg 421 ctgatggaca acctgctgac ccgcctgccc aagacgctgg ccaactgcag ccacctgaag 481 acggtgaacc tgagcaacaa ccagctgaag gagttccccg cgatgctgtg cggcctgaag 541 cagctggacg tgctggatct ctcgcggaac aggatcaccg aggtgcccgc cgaggtgggc 601 ggcctgtatg tgaccgagct gaacctgaac cagaaccaaa tctccgccct ggcggaggac 661 gtggccgagt gccccaagct gaagaccctg aggctcgagg agaactgcct ccaggcggcc 721 gccttcacgc cccgcatcct caaggagtcg aagatctgca acctggccgt cgacggcaat 781 ctgttcaact cgaagcagtt caccgatctc gatggctacg atgtgtacat ggagcgctac 841 acggcggtca ggaagaagat gttctagatg ttcggaactc ttggagaact tctttatatc 901 cccctttttt tttgtgtgcg tccttggatt ttatttatca gcttaaacta gtttaatagc 961 ctaattccat atgccttcag tgtaaatcgt tatgaataaa acgaagaaag acaagta