Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii leucine-rich repeat-containing


LOCUS       XM_017157538            1017 bp    mRNA    linear   INV 09-DEC-2024
            protein 57 (LOC108068131), mRNA.
ACCESSION   XM_017157538
VERSION     XM_017157538.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017157538.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1017
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1017
                     /gene="LOC108068131"
                     /note="leucine-rich repeat-containing protein 57; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108068131"
     CDS             151..867
                     /gene="LOC108068131"
                     /codon_start=1
                     /product="leucine-rich repeat-containing protein 57"
                     /protein_id="XP_017013027.1"
                     /db_xref="GeneID:108068131"
                     /translation="MGNKQIKQHLETAQKTGILKISLQRLQEFPPQLKAYPNVLKTLD
                     LSENRFERVPDELGKLTLLKHLNLSGNRLAELNEVVGELAKLEVLLLMDNLLTRLPKT
                     LANCSHLKTVNLSNNQLKEFPAMLCGLKQLDVLDLSRNRITEVPAEVGGLYVTELNLN
                     QNQISALAEDVAECPKLKTLRLEENCLQAAAFTPRILKESKICNLAVDGNLFNSKQFT
                     DLDGYDVYMERYTAVRKKMF"
     misc_feature    <268..>810
                     /gene="LOC108068131"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:443914"
     misc_feature    268..336
                     /gene="LOC108068131"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    337..405
                     /gene="LOC108068131"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    406..474
                     /gene="LOC108068131"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    475..543
                     /gene="LOC108068131"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    544..612
                     /gene="LOC108068131"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    613..678
                     /gene="LOC108068131"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     polyA_site      1017
                     /gene="LOC108068131"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ctaaccagag agcagccacg gtcatactgc taaagaaaac aagtaaatag ttttaattat
       61 ttactaaaag tgctgttaaa cgcgagagga gcgaggatat ccgaccaagc ccacctggat
      121 tagtcatcgg caaccccacc cacccggaaa atgggcaaca agcagataaa acagcacctg
      181 gagacggcgc agaagacggg catcctgaag atctcgctgc agcgcctgca ggagttcccg
      241 ccgcagctga aggcctaccc gaatgtgctg aagaccctcg atctcagcga gaatcgcttc
      301 gagcgcgtgc ccgacgaact gggcaagctg acgctgctga agcacctcaa tctcagcggc
      361 aaccggctgg ccgagctcaa cgaggtggtg ggcgagctgg ccaagctgga ggtgctcctg
      421 ctgatggaca acctgctgac ccgcctgccc aagacgctgg ccaactgcag ccacctgaag
      481 acggtgaacc tgagcaacaa ccagctgaag gagttccccg cgatgctgtg cggcctgaag
      541 cagctggacg tgctggatct ctcgcggaac aggatcaccg aggtgcccgc cgaggtgggc
      601 ggcctgtatg tgaccgagct gaacctgaac cagaaccaaa tctccgccct ggcggaggac
      661 gtggccgagt gccccaagct gaagaccctg aggctcgagg agaactgcct ccaggcggcc
      721 gccttcacgc cccgcatcct caaggagtcg aagatctgca acctggccgt cgacggcaat
      781 ctgttcaact cgaagcagtt caccgatctc gatggctacg atgtgtacat ggagcgctac
      841 acggcggtca ggaagaagat gttctagatg ttcggaactc ttggagaact tctttatatc
      901 cccctttttt tttgtgtgcg tccttggatt ttatttatca gcttaaacta gtttaatagc
      961 ctaattccat atgccttcag tgtaaatcgt tatgaataaa acgaagaaag acaagta