Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii muscarinic Acetylcholine Receptor,


LOCUS       XM_017157531            1344 bp    mRNA    linear   INV 09-DEC-2024
            C-type (mAChR-C), mRNA.
ACCESSION   XM_017157531
VERSION     XM_017157531.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157531.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 3% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1344
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1344
                     /gene="mAChR-C"
                     /note="muscarinic Acetylcholine Receptor, C-type; Derived
                     by automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 2 Proteins"
                     /db_xref="GeneID:108068124"
     CDS             226..1344
                     /gene="mAChR-C"
                     /codon_start=1
                     /product="alpha-1A adrenergic receptor"
                     /protein_id="XP_017013020.2"
                     /db_xref="GeneID:108068124"
                     /translation="MSFSSSSSPPAWDYRSSTDHSILWSRQNATETPTELSLQASSLG
                     AGHFLWLAINALLFALILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGLALP
                     YHLVFYMGSDIGEMRAPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMT
                     RRVAYSIIVSNWCLGAVVALLPVFWNRWPEAQACEFDEVLAPGYIAGVITPGFVIIWI
                     CMLLVYWRIMREASKQAQRLRQSVVYNADEATTMRSLLLHPDWKSVQIVVFIMGCFTL
                     CWLPYFCVAIAQLFSICRSSSLIYKTTFSLAICNSALNPIIYSWKNSGFRRAFAQTLC
                     CRTARQCEDQLPADSKQRMEATSSSTGYQQQQQPEIKQ"
     misc_feature    373..1191
                     /gene="mAChR-C"
                     /note="rhodopsin receptor-like class A family of the
                     seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_classA_rhodopsin-like; cd00637"
                     /db_xref="CDD:410626"
     misc_feature    373..450
                     /gene="mAChR-C"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:410626"
     misc_feature    472..549
                     /gene="mAChR-C"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:410626"
     misc_feature    order(535..537,544..549,583..600,604..609,616..618,
                     751..753,757..771,826..828,835..843,847..855,859..864,
                     1057..1059,1066..1071,1075..1080,1087..1089,1111..1116,
                     1120..1128,1135..1137,1144..1149)
                     /gene="mAChR-C"
                     /note="putative ligand binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:410626"
     misc_feature    583..675
                     /gene="mAChR-C"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:410626"
     misc_feature    712..771
                     /gene="mAChR-C"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:410626"
     misc_feature    826..903
                     /gene="mAChR-C"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:410626"
     misc_feature    997..1089
                     /gene="mAChR-C"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:410626"
     misc_feature    1114..1191
                     /gene="mAChR-C"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:410626"
ORIGIN      
        1 gttatcaacg gattgcggtt ctcacgctgg atcagttatc agttaactgg cggtgacaat
       61 gtcgtagagc cagcagcgaa acgtaaacaa acgacgccca cggtggaacc gaatccaaaa
      121 accgagtcga accgaagtcc tggccaaaaa gctggctgag ctgccagata gttcctcact
      181 ggcgtcgcgt gcgcttcgtt ttgttttgta tctttgtgtg tcagcatgtc attttccagc
      241 agctcatcgc cgcccgcctg ggattatcgg agttccacgg atcactcgat cctgtggagc
      301 aggcagaatg ccacggaaac tcccacggaa ttgagtcttc aggcgagcag cttgggcgcc
      361 ggccatttcc tctggctggc catcaatgcg ctcctgttcg ccctcatcct cggcggcaat
      421 atcctgacca ttgtggcggt tcgcacctgt cgccacctcc gatcggttat ctccaatctc
      481 ttcatcctct cgctggccgt ctccgatttc tgcgtgggtc tggcgctgcc ctaccatttg
      541 gtattctaca tgggctccga tattggcgaa atgagggctc cctgcctgct gcgcttcttc
      601 ctgctcatct gcgcctgctg cgtctccatg ctcacgctga tctccatcgc ggtggatcgg
      661 tacatagccg tggtctatgc cctgcactac agaagataca tgacccgtcg cgtggcctac
      721 agcatcatcg tgtcgaactg gtgcctgggc gccgtggtgg ccctgctgcc ggtcttctgg
      781 aaccgatggc ccgaggcgca ggcctgcgaa ttcgacgagg tcctggcgcc cggctacata
      841 gctggcgtaa taactcccgg cttcgtgatc atctggatct gcatgctcct cgtctactgg
      901 cgcatcatgc gcgaggcctc caagcaggcg cagcgcctcc gccagtcggt ggtctacaat
      961 gcggatgagg ccaccaccat gcggagtctg ctgctccatc cggactggaa gagcgtccag
     1021 attgtggtct tcatcatggg ctgcttcacg ctctgctggc ttccctactt ctgcgtggcc
     1081 attgcccagc tgttcagcat ctgccggagc agctcgctga tctacaagac caccttctcg
     1141 ctggccatct gcaattcggc gctgaatccc atcatttact cgtggaagaa ctccggcttc
     1201 cggcgagcct tcgcccagac tctctgctgc cggacggcga ggcagtgcga ggatcagctg
     1261 ccggcggaca gcaagcagcg catggaggcc acctcctcct ccacgggcta ccagcagcag
     1321 cagcagccgg agatcaagca gtag