Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157531 1344 bp mRNA linear INV 09-DEC-2024 C-type (mAChR-C), mRNA. ACCESSION XM_017157531 VERSION XM_017157531.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157531.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 3% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1344 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1344 /gene="mAChR-C" /note="muscarinic Acetylcholine Receptor, C-type; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108068124" CDS 226..1344 /gene="mAChR-C" /codon_start=1 /product="alpha-1A adrenergic receptor" /protein_id="XP_017013020.2" /db_xref="GeneID:108068124" /translation="MSFSSSSSPPAWDYRSSTDHSILWSRQNATETPTELSLQASSLG AGHFLWLAINALLFALILGGNILTIVAVRTCRHLRSVISNLFILSLAVSDFCVGLALP YHLVFYMGSDIGEMRAPCLLRFFLLICACCVSMLTLISIAVDRYIAVVYALHYRRYMT RRVAYSIIVSNWCLGAVVALLPVFWNRWPEAQACEFDEVLAPGYIAGVITPGFVIIWI CMLLVYWRIMREASKQAQRLRQSVVYNADEATTMRSLLLHPDWKSVQIVVFIMGCFTL CWLPYFCVAIAQLFSICRSSSLIYKTTFSLAICNSALNPIIYSWKNSGFRRAFAQTLC CRTARQCEDQLPADSKQRMEATSSSTGYQQQQQPEIKQ" misc_feature 373..1191 /gene="mAChR-C" /note="rhodopsin receptor-like class A family of the seven-transmembrane G protein-coupled receptor superfamily; Region: 7tm_classA_rhodopsin-like; cd00637" /db_xref="CDD:410626" misc_feature 373..450 /gene="mAChR-C" /note="TM helix 1 [structural motif]; Region: TM helix 1" /db_xref="CDD:410626" misc_feature 472..549 /gene="mAChR-C" /note="TM helix 2 [structural motif]; Region: TM helix 2" /db_xref="CDD:410626" misc_feature order(535..537,544..549,583..600,604..609,616..618, 751..753,757..771,826..828,835..843,847..855,859..864, 1057..1059,1066..1071,1075..1080,1087..1089,1111..1116, 1120..1128,1135..1137,1144..1149) /gene="mAChR-C" /note="putative ligand binding pocket [chemical binding]; other site" /db_xref="CDD:410626" misc_feature 583..675 /gene="mAChR-C" /note="TM helix 3 [structural motif]; Region: TM helix 3" /db_xref="CDD:410626" misc_feature 712..771 /gene="mAChR-C" /note="TM helix 4 [structural motif]; Region: TM helix 4" /db_xref="CDD:410626" misc_feature 826..903 /gene="mAChR-C" /note="TM helix 5 [structural motif]; Region: TM helix 5" /db_xref="CDD:410626" misc_feature 997..1089 /gene="mAChR-C" /note="TM helix 6 [structural motif]; Region: TM helix 6" /db_xref="CDD:410626" misc_feature 1114..1191 /gene="mAChR-C" /note="TM helix 7 [structural motif]; Region: TM helix 7" /db_xref="CDD:410626" ORIGIN 1 gttatcaacg gattgcggtt ctcacgctgg atcagttatc agttaactgg cggtgacaat 61 gtcgtagagc cagcagcgaa acgtaaacaa acgacgccca cggtggaacc gaatccaaaa 121 accgagtcga accgaagtcc tggccaaaaa gctggctgag ctgccagata gttcctcact 181 ggcgtcgcgt gcgcttcgtt ttgttttgta tctttgtgtg tcagcatgtc attttccagc 241 agctcatcgc cgcccgcctg ggattatcgg agttccacgg atcactcgat cctgtggagc 301 aggcagaatg ccacggaaac tcccacggaa ttgagtcttc aggcgagcag cttgggcgcc 361 ggccatttcc tctggctggc catcaatgcg ctcctgttcg ccctcatcct cggcggcaat 421 atcctgacca ttgtggcggt tcgcacctgt cgccacctcc gatcggttat ctccaatctc 481 ttcatcctct cgctggccgt ctccgatttc tgcgtgggtc tggcgctgcc ctaccatttg 541 gtattctaca tgggctccga tattggcgaa atgagggctc cctgcctgct gcgcttcttc 601 ctgctcatct gcgcctgctg cgtctccatg ctcacgctga tctccatcgc ggtggatcgg 661 tacatagccg tggtctatgc cctgcactac agaagataca tgacccgtcg cgtggcctac 721 agcatcatcg tgtcgaactg gtgcctgggc gccgtggtgg ccctgctgcc ggtcttctgg 781 aaccgatggc ccgaggcgca ggcctgcgaa ttcgacgagg tcctggcgcc cggctacata 841 gctggcgtaa taactcccgg cttcgtgatc atctggatct gcatgctcct cgtctactgg 901 cgcatcatgc gcgaggcctc caagcaggcg cagcgcctcc gccagtcggt ggtctacaat 961 gcggatgagg ccaccaccat gcggagtctg ctgctccatc cggactggaa gagcgtccag 1021 attgtggtct tcatcatggg ctgcttcacg ctctgctggc ttccctactt ctgcgtggcc 1081 attgcccagc tgttcagcat ctgccggagc agctcgctga tctacaagac caccttctcg 1141 ctggccatct gcaattcggc gctgaatccc atcatttact cgtggaagaa ctccggcttc 1201 cggcgagcct tcgcccagac tctctgctgc cggacggcga ggcagtgcga ggatcagctg 1261 ccggcggaca gcaagcagcg catggaggcc acctcctcct ccacgggcta ccagcagcag 1321 cagcagccgg agatcaagca gtag