PREDICTED: Drosophila takahashii Ataxin 1 (Atx-1), mRNA.

LOCUS       XM_017157527             722 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017157527
VERSION     XM_017157527.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157527.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..722
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..722
                     /gene="Atx-1"
                     /note="Ataxin 1; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 1 Protein"
                     /db_xref="GeneID:108068120"
     CDS             40..678
                     /gene="Atx-1"
                     /codon_start=1
                     /product="ataxin-1-like"
                     /protein_id="XP_017013016.2"
                     /db_xref="GeneID:108068120"
                     /translation="MQMHMELSYGRYPPAAPAPPVTSSEEYDPCFRRGSYIELASGAM
                     RRVEDIRTEDFIQSSLRSQIFELREATVVRMDRSASPGHVILTFSYDTRHAKMDLEVL
                     PGHPMFVYGQGWASCNPQLSQQLYELKCQQLQVGDICLSLVPRQQPVAPRPPPPPPPC
                     PPPPPPPPVELPVSMASPPAGAGYGLHPYQVYAQMASFVAVYTQHMMEKLNN"
     misc_feature    127..471
                     /gene="Atx-1"
                     /note="domain in Ataxins and HMG containing proteins;
                     Region: AXH; smart00536"
                     /db_xref="CDD:197779"
ORIGIN      
        1 ccggggaaac caaatcagtt gaggaattgc cgttgcaaaa tgcagatgca catggagttg
       61 tcatacggga ggtatcctcc agctgctcct gctcctccag tgacctccag tgaggaatac
      121 gatccctgct tccgcagggg atcctatata gagctggcca gcggagccat gcgccgtgtg
      181 gaggacattc gcaccgagga cttcatccag tcgtcgctgc gcagccagat cttcgagctg
      241 cgcgaggcca cggtggtcag gatggataga agtgcctctc ccggccatgt gatcctcacc
      301 tttagctacg acacccggca cgccaagatg gatttggagg tgctgccggg tcatccaatg
      361 tttgtttacg gccagggttg ggcctcctgc aatccccagc tctcccagca gttgtacgaa
      421 ctcaagtgcc agcagctgca ggtgggcgac atctgtttgt cgctggtgcc gcgccagcag
      481 ccagtggctc cacgtcctcc tccgccgccg ccgccatgtc ctcctcctcc tccgccgccg
      541 ccagttgagc tgcccgtttc catggcttct cctcccgccg gagcgggcta tggactgcat
      601 ccctaccagg tttatgccca aatggccagc tttgtggccg tctacacgca gcacatgatg
      661 gagaagctga ataattagat gtaaaaactt gtaaaggcgt ttcggggata tattcagcga
      721 ta