Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157518 721 bp mRNA linear INV 09-DEC-2024 (ATPsyndelta), transcript variant X2, mRNA. ACCESSION XM_017157518 VERSION XM_017157518.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017157518.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..721 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..721 /gene="ATPsyndelta" /note="ATP synthase, delta subunit; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108068111" CDS 104..577 /gene="ATPsyndelta" /codon_start=1 /product="ATP synthase subunit delta, mitochondrial" /protein_id="XP_017013007.1" /db_xref="GeneID:108068111" /translation="MSFVKNARLLAARGARLAQNRSYSDEMKLTFAAANKTFYDAAVV RQIDVPSFSGSFGILAKHVPTLAVLKPGVVQVVENDGKLLKFFVSSGSVTVNDDSSVQ VLAEEAHNVEDIDANEARQLLAKYQSELSSAGDDKAKAKAAIAVEVAEALVKAAE" misc_feature 182..511 /gene="ATPsyndelta" /note="mitochondrial ATP synthase delta subunit; Region: F1-ATPase_delta; cd12152" /db_xref="CDD:213395" misc_feature order(191..193,200..208,212..214,221..223,290..304, 371..388,407..409,413..421) /gene="ATPsyndelta" /note="gamma subunit interface [polypeptide binding]; other site" /db_xref="CDD:213395" misc_feature order(239..241,245..247,263..268,272..274,278..280, 284..292,332..334) /gene="ATPsyndelta" /note="LBP interface [polypeptide binding]; other site" /db_xref="CDD:213395" polyA_site 721 /gene="ATPsyndelta" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cactgttctg tcagttgccc agccctggtc taagttacga agcaaacaga acttcagcaa 61 gttttctcgt gtttttcgcc atcaaaaccg aactagcaaa agaatgtcct tcgtgaagaa 121 cgcacgtctg ctggccgccc gcggcgcccg tttggcccaa aacaggagct attcggacga 181 gatgaagctc accttcgccg ccgccaacaa aaccttttac gatgctgccg tcgtgcgcca 241 aatcgatgtg ccctccttct cgggatcctt cggcatcctg gccaagcacg tgcccactct 301 ggccgttctg aagcccggcg tcgtccaggt ggtggagaac gatggcaagc tgctcaagtt 361 cttcgtctcc agcggctccg tcaccgtcaa cgatgactcc tccgtccagg tgctcgccga 421 ggaggcccac aacgtcgagg acatcgatgc caacgaggcg cgccagctgc tcgccaagta 481 ccagtccgag ctcagctccg ccggcgacga taaggccaag gcaaaggctg ccatcgccgt 541 ggaggtcgcc gaggcgttag tcaaggctgc cgaatagacg taatcaccac actaccgcca 601 ccaataaacc acaatcgatg ctttgtgtct gaaattaata aaacatagcg atcggcttga 661 agagaaagag cgttatgaaa caataaaaag cgaatcataa tatcgtatta atgacccgtg 721 a