Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157517 740 bp mRNA linear INV 09-DEC-2024 (ATPsyndelta), transcript variant X1, mRNA. ACCESSION XM_017157517 VERSION XM_017157517.2 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Oct 18, 2021 this sequence version replaced XM_017157517.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..740 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..740 /gene="ATPsyndelta" /note="ATP synthase, delta subunit; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108068111" CDS 123..596 /gene="ATPsyndelta" /codon_start=1 /product="ATP synthase subunit delta, mitochondrial" /protein_id="XP_017013006.1" /db_xref="GeneID:108068111" /translation="MSFVKNARLLAARGARLAQNRSYSDEMKLTFAAANKTFYDAAVV RQIDVPSFSGSFGILAKHVPTLAVLKPGVVQVVENDGKLLKFFVSSGSVTVNDDSSVQ VLAEEAHNVEDIDANEARQLLAKYQSELSSAGDDKAKAKAAIAVEVAEALVKAAE" misc_feature 201..530 /gene="ATPsyndelta" /note="mitochondrial ATP synthase delta subunit; Region: F1-ATPase_delta; cd12152" /db_xref="CDD:213395" misc_feature order(210..212,219..227,231..233,240..242,309..323, 390..407,426..428,432..440) /gene="ATPsyndelta" /note="gamma subunit interface [polypeptide binding]; other site" /db_xref="CDD:213395" misc_feature order(258..260,264..266,282..287,291..293,297..299, 303..311,351..353) /gene="ATPsyndelta" /note="LBP interface [polypeptide binding]; other site" /db_xref="CDD:213395" polyA_site 740 /gene="ATPsyndelta" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tgcgcacctt gcaacactgt tctgtcagtt gcccagccct ggtctaagtt acgaagcaaa 61 cagaacttca gcaagttttc tcgtgttttt cgccatcaaa accgaactag caaaagtaca 121 gaatgtcctt cgtgaagaac gcacgtctgc tggccgcccg cggcgcccgt ttggcccaaa 181 acaggagcta ttcggacgag atgaagctca ccttcgccgc cgccaacaaa accttttacg 241 atgctgccgt cgtgcgccaa atcgatgtgc cctccttctc gggatccttc ggcatcctgg 301 ccaagcacgt gcccactctg gccgttctga agcccggcgt cgtccaggtg gtggagaacg 361 atggcaagct gctcaagttc ttcgtctcca gcggctccgt caccgtcaac gatgactcct 421 ccgtccaggt gctcgccgag gaggcccaca acgtcgagga catcgatgcc aacgaggcgc 481 gccagctgct cgccaagtac cagtccgagc tcagctccgc cggcgacgat aaggccaagg 541 caaaggctgc catcgccgtg gaggtcgccg aggcgttagt caaggctgcc gaatagacgt 601 aatcaccaca ctaccgccac caataaacca caatcgatgc tttgtgtctg aaattaataa 661 aacatagcga tcggcttgaa gagaaagagc gttatgaaac aataaaaagc gaatcataat 721 atcgtattaa tgacccgtga