Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Carbonic anhydrase-related protein


LOCUS       XM_017157514            1615 bp    mRNA    linear   INV 09-DEC-2024
            B (CARPB), transcript variant X1, mRNA.
ACCESSION   XM_017157514
VERSION     XM_017157514.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157514.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1615
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1615
                     /gene="CARPB"
                     /note="Carbonic anhydrase-related protein B; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:108068110"
     CDS             420..1403
                     /gene="CARPB"
                     /codon_start=1
                     /product="carbonic anhydrase-related protein 10"
                     /protein_id="XP_017013003.1"
                     /db_xref="GeneID:108068110"
                     /translation="MELLQALCCTLLLLLARMQVLLAVSWEDWWTYDGISGPAFWGLI
                     NPEWSLCNKGRRQSPVNLEPQRLLFDPNLRPMHIDKHRISGLITNTGHSVIFTAGNDT
                     VANYDGMQTPVNISGGPLSYRYRFHEIHMHYGLNDQFGSEHSVEGYTFPAEIQIFGYN
                     SQLYANFSDALNRAQGIVGVSILLQLGDLSNAELRMLTDQLERIRYGGDEAFVKRLSI
                     RGLLPETDHYMTYDGSTTAPACHETVTWVVLNKPIYITKQQLHALRRLMQGSPDHPKA
                     PLGNNYRPPQPLLHRPIRTNIDFKTTKTNGKAACPTMYREVYYKATSWKQN"
     misc_feature    528..1313
                     /gene="CARPB"
                     /note="Carbonic anhydrase alpha related protein: groups X,
                     XI and related proteins. This subgroup contains carbonic
                     anhydrase related proteins (CARPs) X and XI, which have
                     been implicated in various biological processes of the
                     central nervous system. CARPs are...; Region:
                     alpha_CARP_X_XI_like; cd03121"
                     /db_xref="CDD:239395"
ORIGIN      
        1 aaataataat tatagaagaa aaagaaaaac acacacacac acatatcaag ttaaccgatt
       61 tattaatgat ttttgttgtt tttgttgcgt gtcggcatta aaccaaaaga aaaaaataga
      121 aagagaacaa caagtcttcg gtcgccagaa ttaatcaaat taaaagtact tggccgtgca
      181 attacgcaga atgccgtttg ccttttaagt tgcatattgt tcgacgatcg gcggaggagc
      241 agcaggagga ggaaaagcgg aaaagcgcgg aaaaacggac gttagtgaag tggagaggag
      301 tggagtccga ggagtcggag gagtgaagtg ccactgacag tggcagtaag ttacgggcca
      361 agtttcgccg gagtcgcctt gtcgctggcg caactggcat aactcagagc tgatgaaata
      421 tggagctgct gcaggccctc tgctgcacgc tgctcctgct tttggcccgg atgcaagttc
      481 tgctcgccgt cagctgggag gattggtgga catacgatgg catctccggt cctgccttct
      541 ggggcctcat caatccggag tggtcgctct gcaacaaggg tcgtcgccag tcgccggtca
      601 atctggagcc ccagcgcctg ctcttcgatc ccaacttgag gcccatgcac atagacaagc
      661 acaggatatc cggactgatc actaatacgg gccacagcgt catcttcacg gccggcaacg
      721 atacggtggc caactacgat ggcatgcaga cgcctgtgaa catctccggc ggaccgctct
      781 cgtaccgcta ccgcttccac gagatccaca tgcactacgg cctgaacgac cagttcggat
      841 cggagcacag cgtcgagggc tacacgttcc cggcggagat acaaatattc ggctacaatt
      901 cccagctgta tgcaaatttc tcagatgccc tcaatcgcgc ccagggcatt gtgggcgtct
      961 ccattctgct gcagcttgga gacctctcga atgcggagct gcgcatgctt actgatcagc
     1021 tggagcgcat tcgctatggc ggcgatgagg cgtttgtgaa gcgactctcg attcgcggat
     1081 tgctgccgga aacggatcac tatatgacct acgatggatc aacaacggca ccagcctgcc
     1141 acgaaacagt cacttgggtg gtgctcaaca agcccattta cataacaaag caacagttgc
     1201 acgccctgcg ccgcctgatg cagggcagcc ccgaccaccc gaaagcgccc ctgggcaaca
     1261 attacaggcc gccccagccg ctgctgcacc ggcccattcg caccaacatt gacttcaaga
     1321 cgacgaagac gaacggcaag gccgcctgcc ccaccatgta ccgcgaggtc tactacaaag
     1381 cgaccagttg gaaacagaac taaaagtcgg cggcgtgatg gcgtaacgta acgtaacgta
     1441 tcgtaagcgt aagcgtatga cgtaagtagc gagcggcgtg caacaggagc ttccactaaa
     1501 catacatata aacaaggcga tgccgaggga aaagaaaagg gaaggattga aagaaaagga
     1561 tcacaaggaa atcagtgcag caaaatggcg attggaaata cacacaaacc cacac