PREDICTED: Drosophila takahashii rab-like protein 3 (LOC108068106),

LOCUS       XM_017157509             975 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017157509
VERSION     XM_017157509.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157509.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..975
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..975
                     /gene="LOC108068106"
                     /note="rab-like protein 3; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108068106"
     CDS             31..891
                     /gene="LOC108068106"
                     /codon_start=1
                     /product="rab-like protein 3"
                     /protein_id="XP_017012998.2"
                     /db_xref="GeneID:108068106"
                     /translation="MRLPWSHCRMAMNNRVRIVVVGDSGVGKTCLTHLIAHNESLIRP
                     GWTVGCNIQVKIHEFKEGTARQCPYFVELFDVGGSLSHKNTRSVFYTGVHGIILVHDL
                     TNGKSQEQLLDWLYEIVNKEGKDTYKSRGSSLPPSPTTPLSSFSSNTSGTDGHIRFDM
                     EEFLGATQTPILVMGTKLDLIDEKRQPKTAVKKAGGIADKCGAEEIWLNCRDNRSLAA
                     GTTDAVKLSRFFDCVIEKRESLGGSGGHVFGMGGGFTAGGPPDRRRYGPTVGKLEPSA
                     VPLLETDDLK"
     misc_feature    76..741
                     /gene="LOC108068106"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    94..117
                     /gene="LOC108068106"
                     /note="G1 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(100..120,262..264,556..561,565..567,685..693)
                     /gene="LOC108068106"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206648"
     misc_feature    169..171
                     /gene="LOC108068106"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    181..189
                     /gene="LOC108068106"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    253..264
                     /gene="LOC108068106"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(259..264,310..315)
                     /gene="LOC108068106"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    556..567
                     /gene="LOC108068106"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    685..693
                     /gene="LOC108068106"
                     /note="G5 box; other site"
                     /db_xref="CDD:206648"
     polyA_site      975
                     /gene="LOC108068106"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttttggtata ttttacagac ccttatttga atgcgcctgc catggtcaca ctgcagaatg
       61 gccatgaaca accgggtgcg gattgttgtt gtcggagatt cgggcgtggg caagacctgc
      121 ctgacgcacc tgatcgccca caacgagtcg ctgatccgac ctggctggac ggtcggctgc
      181 aacatccagg tgaagatcca cgagttcaag gagggcaccg cccgccagtg cccctacttc
      241 gtggagctct tcgatgtcgg cggctcgctg agccacaaga acacccgcag cgtcttctac
      301 acgggcgtcc atgggatcat attggtccac gacctgacca acggcaagtc gcaggagcag
      361 ctgctcgact ggctgtacga gatcgtcaac aaggagggca aggacacgta caagtcgcgc
      421 ggcagctccc tgcccccctc gccgaccacc ccgctgagca gtttctcctc aaatacctct
      481 ggcaccgatg gacacatccg tttcgacatg gaggagttcc tgggcgccac gcagacgccc
      541 atcctggtga tgggcaccaa gctggacctc atcgacgaga agcgccagcc gaagacggcg
      601 gtgaagaagg cgggcggcat tgccgacaag tgtggcgccg aggagatctg gctgaattgc
      661 cgggacaacc gcagtctggc cgccggcacc accgatgccg tgaagctgtc ccgcttcttc
      721 gactgtgtga tcgagaagcg ggagtccctg ggcggcagcg gaggtcatgt attcggaatg
      781 ggcggcggct tcaccgctgg cggtccgccg gacaggcgtc gctatggtcc gaccgtcggc
      841 aaactggagc ccagtgccgt tcccctgctg gagaccgacg acctcaagtg attaatgcat
      901 tcaatgttag ctttaagtca ggttgtacat cttttatatc gtgcgataat cattaaaatc
      961 gaaaggcaat attta