PREDICTED: Drosophila takahashii Ribosomal protein S28b (RpS28b),

LOCUS       XM_017157506             417 bp    mRNA    linear   INV 09-DEC-2024
            mRNA.
ACCESSION   XM_017157506
VERSION     XM_017157506.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157506.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..417
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..417
                     /gene="RpS28b"
                     /note="Ribosomal protein S28b; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108068102"
     CDS             79..276
                     /gene="RpS28b"
                     /codon_start=1
                     /product="small ribosomal subunit protein eS28"
                     /protein_id="XP_017012995.1"
                     /db_xref="GeneID:108068102"
                     /translation="MDKPVVWARVMKVLGRTGSQGQCTQVKVEFLGEQNRQIIRNVKG
                     PVREGDILTLLESEREARRLR"
     misc_feature    100..273
                     /gene="RpS28b"
                     /note="S28E, S1-like RNA-binding domain. S1-like
                     RNA-binding domains are found in a wide variety of
                     RNA-associated proteins. S28E protein is a component of
                     the 30S ribosomal subunit. S28E is highly conserved among
                     archaea and eukaryotes. S28E may control...; Region:
                     S1_S28E; cd04457"
                     /db_xref="CDD:239904"
     misc_feature    order(109..111,157..159,193..195,199..201)
                     /gene="RpS28b"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239904"
     polyA_site      417
                     /gene="RpS28b"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 agcaacttcc tttttgcttg cggctgtcaa ttgaagcgca acttgcacgt gaattctctg
       61 cgaatttagc gatttaacat ggacaaacca gttgtttggg cacgcgtgat gaaggttctg
      121 ggccgcaccg gctcccaggg ccaatgtacg caggtgaagg tggagttcct cggcgagcag
      181 aaccgccaga tcatccggaa tgtgaaggga cccgtgcgcg agggcgacat cctgaccctt
      241 ttggagtccg aacgcgaggc caggaggctg cgctaattgg cgacccgctc gagaggacct
      301 tttttacaca ctgtttttgc acgcggcttt tttctgagga aatctgcgga cggctgctgc
      361 tgaaatattc tcgttataaa caaatgaaaa tacacaccta attcgccaga aaaatca