Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157505 792 bp mRNA linear INV 09-DEC-2024 (LOC108068101), mRNA. ACCESSION XM_017157505 VERSION XM_017157505.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157505.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..792 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..792 /gene="LOC108068101" /note="uncharacterized LOC108068101; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108068101" CDS 65..649 /gene="LOC108068101" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017012994.2" /db_xref="GeneID:108068101" /translation="MLLPADRLEHHKTSLEQQLKLLATSIRSYLAVKAAETPELSNRA NRLWELSQRYRLVKGTNQAATFALLSVCQDVYQSLQDSVLKLAYELAQISVQVADFEI ACLQLSQEQGKSQKTPTNLIEFRNFLEESLKLLQNQVKYLELHLRQLQPKFAAPESSL DTFRSDLQLPEHAEARISLGLAKIEKLASFPLVL" ORIGIN 1 cagttatcga atggtgtggc tcgcacattt tacaaattaa attacaattc acagctttta 61 cgcgatgtta ttgccagcag atcgtttgga gcaccacaag accagtttgg agcaacagct 121 gaagctattg gccaccagca taaggagcta tctagcggtg aaagcagccg aaacacctga 181 attgtcgaat cgagcgaacc gcttgtggga actgagtcaa cgatatcgcc tggttaaggg 241 taccaatcaa gctgccacct ttgccctgct ttctgtgtgc caggatgtct accaaagcct 301 gcaggacagc gtactgaaac ttgcttatga actagcccag atatccgtcc aagtagccga 361 cttcgagatc gcctgcctgc agctgagtca agagcaaggc aaaagccaaa agacgcccac 421 aaatttaata gaatttcgga atttcctgga ggaatccctc aagctgctgc agaaccaggt 481 caaatatctg gagctccatc tgcgccagct gcaaccgaaa tttgcggccc cggaatcctc 541 gctggatacc tttagatccg atcttcaatt gcctgaacac gccgaagctc gaatttcact 601 gggactggcc aaaatcgaaa agctcgccag ttttccactc gtcttgtagt ttgttagtag 661 gatcttctta gtcgtattac tattctttct gtaaaatatc gttatatctt ttgtaaaata 721 actgcctaga tttaccgcct ttttattgtg atttaaatgt tgtggctgaa aagaaaatac 781 aaacaatcct cg