Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157502 446 bp mRNA linear INV 09-DEC-2024 (LOC108068098), mRNA. ACCESSION XM_017157502 VERSION XM_017157502.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157502.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..446 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..446 /gene="LOC108068098" /note="uncharacterized LOC108068098; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108068098" CDS 36..389 /gene="LOC108068098" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017012991.1" /db_xref="GeneID:108068098" /translation="MKYTVLILFAIAAFVLPAFAGNDYLWGTIGDNDYKLAKDTVKKA FFVGLKVKKTYTFKQSDNLNALTITAIKVTDKKKSHGATAVLKSGGPGSKGATIAFTS DKNYGISDVVEIWGR" misc_feature 111..383 /gene="LOC108068098" /note="Transcription activator MBF2; Region: MBF2; pfam15868" /db_xref="CDD:464913" polyA_site 446 /gene="LOC108068098" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttgaagtgtt tcgtcattgc gaaatagtta tcaaaatgaa atataccgtg cttattttat 61 tcgccatcgc ggcatttgtt ttgccagcct tcgcaggcaa cgactacctt tggggcacaa 121 tcggggacaa cgactacaaa ttggctaagg atacggttaa gaaggcattt ttcgttggcc 181 tgaaggtgaa gaaaacgtat acatttaagc agtcggacaa ccttaacgcg ctcaccatca 241 cggcaatcaa ggttacggac aaaaagaaga gccacggtgc cactgccgta ctcaaaagtg 301 gaggtcctgg atcgaaggga gctaccattg cctttacctc agacaagaat tatgggatca 361 gtgatgttgt ggaaatatgg ggtcgttaaa gtacatttct aaaatcgtgt ctttgtgccc 421 aaggaattat aactaatgca tgaaaa