Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017157502             446 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068098), mRNA.
ACCESSION   XM_017157502
VERSION     XM_017157502.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157502.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..446
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..446
                     /gene="LOC108068098"
                     /note="uncharacterized LOC108068098; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108068098"
     CDS             36..389
                     /gene="LOC108068098"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017012991.1"
                     /db_xref="GeneID:108068098"
                     /translation="MKYTVLILFAIAAFVLPAFAGNDYLWGTIGDNDYKLAKDTVKKA
                     FFVGLKVKKTYTFKQSDNLNALTITAIKVTDKKKSHGATAVLKSGGPGSKGATIAFTS
                     DKNYGISDVVEIWGR"
     misc_feature    111..383
                     /gene="LOC108068098"
                     /note="Transcription activator MBF2; Region: MBF2;
                     pfam15868"
                     /db_xref="CDD:464913"
     polyA_site      446
                     /gene="LOC108068098"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttgaagtgtt tcgtcattgc gaaatagtta tcaaaatgaa atataccgtg cttattttat
       61 tcgccatcgc ggcatttgtt ttgccagcct tcgcaggcaa cgactacctt tggggcacaa
      121 tcggggacaa cgactacaaa ttggctaagg atacggttaa gaaggcattt ttcgttggcc
      181 tgaaggtgaa gaaaacgtat acatttaagc agtcggacaa ccttaacgcg ctcaccatca
      241 cggcaatcaa ggttacggac aaaaagaaga gccacggtgc cactgccgta ctcaaaagtg
      301 gaggtcctgg atcgaaggga gctaccattg cctttacctc agacaagaat tatgggatca
      361 gtgatgttgt ggaaatatgg ggtcgttaaa gtacatttct aaaatcgtgt ctttgtgccc
      421 aaggaattat aactaatgca tgaaaa