Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157498 1480 bp mRNA linear INV 09-DEC-2024 mRNA. ACCESSION XM_017157498 VERSION XM_017157498.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157498.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1480 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1480 /gene="Arp10" /note="Actin-related protein 10; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108068095" CDS 125..1264 /gene="Arp10" /codon_start=1 /product="actin-related protein 10" /protein_id="XP_017012987.2" /db_xref="GeneID:108068095" /translation="MPIYESVMQEKPPIVLDIGTAYTKLGFAAEAYPRKIMPTEVVMT ATGIRKRLLDYETTEELYDQLVDFLQTIFFKHLLVSPKERKFVLVENVFGPTVLRETL ARVLFVHFDVSSVLFVPVHLIALSTLAVPTALVVDIGYSETSIMPVFSGVQIMAAFKD QSYGGRAIHAEIRRQLVATGVKESLLTESVLEDIKVRTCFVTTMERAQARGGDTKQDK PTPAPAVDYIVSDNDAIIQVPGDLRETVYEIMFEPSNERDSLPHLILRSILDCTLDVR RSLVESVFLVGGGAMVQGLLARLRQELQHLLANDPFYAERFHGELQFKFFNAIGKQNF TAWLGGALCGATDLIQTRSLAKETYLKSEHVPDWSNLCDNRPTGS" misc_feature 164..1237 /gene="Arp10" /note="nucleotide-binding domain (NBD) of actin-related protein 10 (Arp10) and similar proteins; Region: ASKHA_NBD_Arp10; cd10207" /db_xref="CDD:466813" polyA_site 1480 /gene="Arp10" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agttcgcggt tatcgataga cggcagctgc ttaccatttt ggtttggctt ggccaaaatt 61 aaccgaataa aatagaataa taaatagttt agcccatcgg ttcctggaac aactagtagc 121 caacatgccc atctacgaga gcgtcatgca ggagaagcct cccattgtcc tggacatcgg 181 caccgcctac acaaagctgg gattcgcggc ggaggcgtat ccgcggaaga taatgcccac 241 ggaggtggtg atgacggcga cggggatcag gaagcggctc ctcgactacg agacaacgga 301 ggagctgtac gaccagctgg tggacttcct gcagacgatc tttttcaagc acctgctggt 361 cagtcccaag gagcgcaagt tcgtgctggt ggagaatgta ttcggaccca cagttctacg 421 cgaaaccctc gcccgcgtgc tcttcgtcca cttcgacgtc tcctcggtgc tcttcgtgcc 481 cgtccatctc atcgccctgt ccacgctggc cgtgcccacc gctttggtgg tggacattgg 541 ctacagcgag accagcataa tgcccgtctt cagtggcgtc cagatcatgg ccgccttcaa 601 ggatcagagc tacgggggac gggccattca tgcggagatc aggcgtcagt tggtggcgac 661 gggcgtcaag gagagcctgc tgacggagag cgtgctggag gacatcaagg tgcgaacgtg 721 cttcgtgacc accatggaaa gagcccaagc cagaggagga gatactaaac aggataagcc 781 gactcccgcg ccagccgttg attacatagt cagcgacaac gatgccatca tccaggtgcc 841 cggcgatttg cgcgagacgg tctacgagat catgtttgag ccgagcaacg agcgggacag 901 cctgccgcac ctcatcctgc gctccatact cgattgtaca ctcgatgtaa gacgttcgtt 961 ggtggagagt gtgttcctgg tgggcggcgg ggcgatggtt cagggtttgc tggcccgact 1021 gcgccaggaa ctgcagcatc tgctggccaa cgatccgttc tacgccgaac gcttccatgg 1081 cgagctgcag ttcaagttct tcaatgccat cggcaagcag aacttcaccg cctggctggg 1141 cggcgccctc tgcggagcca cggatctcat ccagacgagg tcgctggcca aggagacgta 1201 tctgaagagc gagcatgtgc ccgactggag caacctgtgc gacaatcggc cgacgggatc 1261 gtagacatac taatttactc atgattgtaa tgtattatat aggcttaaag tatagaattt 1321 ctaggcaaac atgttttgga attaaattct ctacatattt aaataactat agccacgccc 1381 ccagttaaag gaatgtattt ttttgtatgg aaaatcggtt caacatttat taacaaatgc 1441 ttttttttta caatctctta ttaaataact tgttcatgca