Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii NAD(P)HX epimerase (Naxe), mRNA.


LOCUS       XM_017157496            1138 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017157496
VERSION     XM_017157496.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157496.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1138
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1138
                     /gene="Naxe"
                     /note="NAD(P)HX epimerase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 5
                     Proteins"
                     /db_xref="GeneID:108068093"
     CDS             104..931
                     /gene="Naxe"
                     /codon_start=1
                     /product="NAD(P)H-hydrate epimerase"
                     /protein_id="XP_017012985.2"
                     /db_xref="GeneID:108068093"
                     /translation="MSLLHRPIGASLKGISRLIHPLLAPQNRKKLETPLNIKRFLAGK
                     RMNLKYLNQKEAIAVDQELFGEYQFSVDQLMELAGLSCAHAVAKCFAAEKHPRILVCC
                     GPGNNGGDGLVAARHLRLMGYTPTIYYPKPTANRLYESLSHQCQRMEIPSIEECPSVT
                     SAACSYDLILDALFGFSFKPPVRADFLAVVELLQQTKLPIASVDIPSGWDVEKGKVTE
                     CDLEPALLISLTAPKLCARQFRGEHHYLGGRFVPPALQRKYELNLPVYPGNELCVKL"
     misc_feature    242..>928
                     /gene="Naxe"
                     /note="pyridoxine (pyridoxamine) 5'-phosphate oxidase;
                     Provisional; Region: PLN03049"
                     /db_xref="CDD:215550"
ORIGIN      
        1 actccgcaga cagctgtttg aaaacttgat aacttgcaga aattaaaatc ttgattaaaa
       61 ttaaattcca cagggaagta cacctgaatt gaaagggaaa tctatgagcc tgcttcaccg
      121 gccaattggc gcgtccttga agggcatttc ccggctgatc cacccactgt tggcaccaca
      181 aaacaggaaa aaactagaaa caccactgaa tatcaagcga ttcctcgccg gcaaaaggat
      241 gaatttaaag tacctcaacc aaaaggaggc catcgccgtg gaccaggagc tcttcggcga
      301 gtaccagttc agcgtggacc agctgatgga gctggccggc ctgagctgcg cccacgcggt
      361 ggccaagtgc tttgccgccg agaagcatcc gcgaatcctc gtctgctgcg gtcccgggaa
      421 caacggaggc gacggcctgg tggccgcccg gcacctgcgg ctcatgggct acacgcccac
      481 catctactac cccaagccga cggccaaccg gctgtacgag agcctcagtc accagtgcca
      541 gaggatggag atcccgagca tcgaggagtg tccatcggtg accagcgccg cctgcagcta
      601 cgacctcatc ctggacgccc tcttcggctt cagcttcaag cccccggtgc gggccgactt
      661 cctggccgtc gtggagctgc tgcagcagac caaactgccg attgccagcg tggacatccc
      721 aagcggctgg gacgtggaga agggcaaggt gactgaatgc gacttggagc ccgctctgct
      781 catctcgctg actgccccga agctttgtgc ccgccagttc cgcggggagc atcactacct
      841 gggcggccga ttcgtaccgc cggccctgca gcgcaagtac gaactgaatc tgcccgtcta
      901 tccgggcaac gaactgtgcg tcaagctgtg atttatacat ttatacgatg cccgattggt
      961 aaataaataa tccaatccca aattgcggct ttctgcccat ttttggccat ctgagatgga
     1021 tagttggttt gaaaattgag tgtaaaaagg tataattttg aatgtaaaaa tgattgggct
     1081 ttctgaaaat ataaattaaa tattgtatta aaatttaaga gtgatttgaa acgtgagt