Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017157484             443 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068083), mRNA.
ACCESSION   XM_017157484
VERSION     XM_017157484.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157484.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..443
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..443
                     /gene="LOC108068083"
                     /note="uncharacterized LOC108068083; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108068083"
     CDS             9..311
                     /gene="LOC108068083"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017012973.3"
                     /db_xref="GeneID:108068083"
                     /translation="MGAKTKVTAQCDWNPRNEMRSALLSCSCFLLLLLLLLGCSSSCC
                     GSGKVIYFNQLNSSQSLEASKNTTDALGKGMLFDTRGNRCRHGFVRDHHGRCRRLV"
ORIGIN      
        1 agcggcgaat gggagccaaa accaaagtaa cagctcagtg cgattggaac cctcggaacg
       61 agatgcgatc cgcactgctg tcctgctcct gcttccttct gctcctgctg ctgctcctcg
      121 gctgcagctc ctcgtgctgc ggatcgggca aggtgatcta cttcaaccag ctgaactcca
      181 gccagtccct ggaggcctcc aaaaacacca cggatgccct gggcaagggc atgctcttcg
      241 atacgcgcgg caatcgctgt cgccacggct tcgttcgcga tcaccatggg cgctgcagaa
      301 ggctggtcta aaaatacgga atctccccgc ttggctgggt taattttaaa tgcgtgttta
      361 ttttaagtct gtgcgttcta ggagattaag gtgaaagcct aagcaaactg tctacagaac
      421 ctgtaaaaac catatgacag ata