Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157484 443 bp mRNA linear INV 09-DEC-2024 (LOC108068083), mRNA. ACCESSION XM_017157484 VERSION XM_017157484.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157484.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..443 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..443 /gene="LOC108068083" /note="uncharacterized LOC108068083; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108068083" CDS 9..311 /gene="LOC108068083" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017012973.3" /db_xref="GeneID:108068083" /translation="MGAKTKVTAQCDWNPRNEMRSALLSCSCFLLLLLLLLGCSSSCC GSGKVIYFNQLNSSQSLEASKNTTDALGKGMLFDTRGNRCRHGFVRDHHGRCRRLV" ORIGIN 1 agcggcgaat gggagccaaa accaaagtaa cagctcagtg cgattggaac cctcggaacg 61 agatgcgatc cgcactgctg tcctgctcct gcttccttct gctcctgctg ctgctcctcg 121 gctgcagctc ctcgtgctgc ggatcgggca aggtgatcta cttcaaccag ctgaactcca 181 gccagtccct ggaggcctcc aaaaacacca cggatgccct gggcaagggc atgctcttcg 241 atacgcgcgg caatcgctgt cgccacggct tcgttcgcga tcaccatggg cgctgcagaa 301 ggctggtcta aaaatacgga atctccccgc ttggctgggt taattttaaa tgcgtgttta 361 ttttaagtct gtgcgttcta ggagattaag gtgaaagcct aagcaaactg tctacagaac 421 ctgtaaaaac catatgacag ata