Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157482 1405 bp mRNA linear INV 09-DEC-2024 ACCESSION XM_017157482 VERSION XM_017157482.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157482.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1405 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1405 /gene="Ser7" /note="serine protease Ser7; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 Proteins" /db_xref="GeneID:108068082" CDS 121..1329 /gene="Ser7" /codon_start=1 /product="serine protease easter" /protein_id="XP_017012971.2" /db_xref="GeneID:108068082" /translation="MSLLIASLLLALLGASGAQQLGKAIMHFGNCNSAEFGRGTCIEK KDCDFYAVDKLSDLASKQQCFSRQRPDLVCCPRETNIIPPFAPRIGNVTTSPSPSNRS TTLLKLLSSRRPSPPTGIDELPQHPYCGSAFAFRVFGGHETGLYEFPWTVLLEYEILA DRTKDYACGASFIAQRWLVTAAHCIETHGRRLTAAILGEWDRDTDPDCVTYEGERDCA PPHTRVTFDRVLSHERYSNRTYVNDIALLRLSRPVNWLQVKNLEPVCLPPARGRNANQ LAGSAADVSGWGKTESSASSRVKRKAMLTIQAQEQCQEAFAQDSSIVLTEGQMCAGGE IGVDSCAGDSGGPLTVEANTPEGSRHVYLAGIVSIGREHCGQKQISGIYTRVSGYMDW IESTIRANRV" misc_feature 211..348 /gene="Ser7" /note="Clip or disulphide knot domain; Region: CLIP; smart00680" /db_xref="CDD:197829" misc_feature 529..1308 /gene="Ser7" /note="Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cd00190" /db_xref="CDD:238113" misc_feature 529..531 /gene="Ser7" /note="cleavage site [active]" /db_xref="CDD:238113" misc_feature order(667..669,847..849,1150..1152) /gene="Ser7" /note="active site" /db_xref="CDD:238113" misc_feature order(1132..1134,1222..1224,1228..1230) /gene="Ser7" /note="substrate binding sites [chemical binding]; other site" /db_xref="CDD:238113" polyA_site 1405 /gene="Ser7" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 cgccagagat cagtagttga ttgccagcca ctggggacgc agcttcgcca acgactcgag 61 aatcaatcga agcggaaaat acgaatagaa atagagaaga gtgggaaaat ctggaggaaa 121 atgagcctgc taatcgccag cctgctcttg gcccttttgg gagcctcagg ggcccagcaa 181 cttggcaaag ccatcatgca tttcggcaac tgcaactcgg cggaattcgg caggggaacc 241 tgcatcgaga agaaggactg cgacttttac gccgtcgata agctatcgga tttggccagc 301 aaacagcagt gcttctcccg ccagcgaccc gatctggtgt gttgtccccg cgagacgaac 361 atcataccgc cctttgcccc ccgaataggc aatgtgacca ccagtccctc gccgtcgaac 421 aggagcacca ccctgctgaa gctgctatcc agccgccgcc cgtcgccgcc cacggggatc 481 gatgagctgc cccagcaccc gtactgcgga tcggccttcg ccttccgcgt gttcgggggc 541 cacgaaacgg gcctctacga gttcccctgg acggtgctgc tggagtacga gatcctggcg 601 gatcgcacca aggactacgc ctgcggagcc tccttcatcg cccagcgatg gctcgtcacc 661 gcggcccact gcatcgagac gcatggcagg cggctgacgg ccgccattct gggggagtgg 721 gacagggaca cggatcccga ctgcgtgacc tacgaggggg agcgggactg tgccccgccg 781 cacaccagag tgaccttcga tcgcgtcctg tcccacgagc gctactcgaa ccgcacctac 841 gtgaatgaca tagccttgtt gagactttcc cgcccggtga actggctgca ggtgaagaat 901 ctggagcccg tctgcctgcc gccggcgagg ggcaggaacg ccaaccagct ggccggctcg 961 gcggccgacg tctccggctg gggcaagacc gagtcgagtg ccagcagccg ggtgaagcgg 1021 aaggccatgc tgaccatcca ggcgcaggag cagtgccagg aggccttcgc ccaggactcg 1081 agcatcgtgc tcaccgaggg ccagatgtgc gccggcggcg agatcggggt cgattcctgc 1141 gccggcgact ccggcggacc gctgaccgtg gaggccaaca cgccggaggg cagtcggcat 1201 gtctacctcg ccgggatcgt ctccattggc agggagcact gcggccagaa gcaaatctcg 1261 ggcatctaca ccagggtcag cggctacatg gactggatcg agagcaccat tcgggcgaat 1321 cgcgtttgaa gacgtttcgt ttcagcctgt aactcagacc gaaaaccctt gaaaagcgat 1381 taaagcgatt tttgaaatac ataaa