Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii serine protease Ser7 (Ser7), mRNA.


LOCUS       XM_017157482            1405 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017157482
VERSION     XM_017157482.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157482.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1405
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1405
                     /gene="Ser7"
                     /note="serine protease Ser7; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 7
                     Proteins"
                     /db_xref="GeneID:108068082"
     CDS             121..1329
                     /gene="Ser7"
                     /codon_start=1
                     /product="serine protease easter"
                     /protein_id="XP_017012971.2"
                     /db_xref="GeneID:108068082"
                     /translation="MSLLIASLLLALLGASGAQQLGKAIMHFGNCNSAEFGRGTCIEK
                     KDCDFYAVDKLSDLASKQQCFSRQRPDLVCCPRETNIIPPFAPRIGNVTTSPSPSNRS
                     TTLLKLLSSRRPSPPTGIDELPQHPYCGSAFAFRVFGGHETGLYEFPWTVLLEYEILA
                     DRTKDYACGASFIAQRWLVTAAHCIETHGRRLTAAILGEWDRDTDPDCVTYEGERDCA
                     PPHTRVTFDRVLSHERYSNRTYVNDIALLRLSRPVNWLQVKNLEPVCLPPARGRNANQ
                     LAGSAADVSGWGKTESSASSRVKRKAMLTIQAQEQCQEAFAQDSSIVLTEGQMCAGGE
                     IGVDSCAGDSGGPLTVEANTPEGSRHVYLAGIVSIGREHCGQKQISGIYTRVSGYMDW
                     IESTIRANRV"
     misc_feature    211..348
                     /gene="Ser7"
                     /note="Clip or disulphide knot domain; Region: CLIP;
                     smart00680"
                     /db_xref="CDD:197829"
     misc_feature    529..1308
                     /gene="Ser7"
                     /note="Trypsin-like serine protease; Many of these are
                     synthesized as inactive precursor zymogens that are
                     cleaved during limited proteolysis to generate their
                     active forms. Alignment contains also inactive enzymes
                     that have substitutions of the catalytic triad...; Region:
                     Tryp_SPc; cd00190"
                     /db_xref="CDD:238113"
     misc_feature    529..531
                     /gene="Ser7"
                     /note="cleavage site [active]"
                     /db_xref="CDD:238113"
     misc_feature    order(667..669,847..849,1150..1152)
                     /gene="Ser7"
                     /note="active site"
                     /db_xref="CDD:238113"
     misc_feature    order(1132..1134,1222..1224,1228..1230)
                     /gene="Ser7"
                     /note="substrate binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238113"
     polyA_site      1405
                     /gene="Ser7"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgccagagat cagtagttga ttgccagcca ctggggacgc agcttcgcca acgactcgag
       61 aatcaatcga agcggaaaat acgaatagaa atagagaaga gtgggaaaat ctggaggaaa
      121 atgagcctgc taatcgccag cctgctcttg gcccttttgg gagcctcagg ggcccagcaa
      181 cttggcaaag ccatcatgca tttcggcaac tgcaactcgg cggaattcgg caggggaacc
      241 tgcatcgaga agaaggactg cgacttttac gccgtcgata agctatcgga tttggccagc
      301 aaacagcagt gcttctcccg ccagcgaccc gatctggtgt gttgtccccg cgagacgaac
      361 atcataccgc cctttgcccc ccgaataggc aatgtgacca ccagtccctc gccgtcgaac
      421 aggagcacca ccctgctgaa gctgctatcc agccgccgcc cgtcgccgcc cacggggatc
      481 gatgagctgc cccagcaccc gtactgcgga tcggccttcg ccttccgcgt gttcgggggc
      541 cacgaaacgg gcctctacga gttcccctgg acggtgctgc tggagtacga gatcctggcg
      601 gatcgcacca aggactacgc ctgcggagcc tccttcatcg cccagcgatg gctcgtcacc
      661 gcggcccact gcatcgagac gcatggcagg cggctgacgg ccgccattct gggggagtgg
      721 gacagggaca cggatcccga ctgcgtgacc tacgaggggg agcgggactg tgccccgccg
      781 cacaccagag tgaccttcga tcgcgtcctg tcccacgagc gctactcgaa ccgcacctac
      841 gtgaatgaca tagccttgtt gagactttcc cgcccggtga actggctgca ggtgaagaat
      901 ctggagcccg tctgcctgcc gccggcgagg ggcaggaacg ccaaccagct ggccggctcg
      961 gcggccgacg tctccggctg gggcaagacc gagtcgagtg ccagcagccg ggtgaagcgg
     1021 aaggccatgc tgaccatcca ggcgcaggag cagtgccagg aggccttcgc ccaggactcg
     1081 agcatcgtgc tcaccgaggg ccagatgtgc gccggcggcg agatcggggt cgattcctgc
     1141 gccggcgact ccggcggacc gctgaccgtg gaggccaaca cgccggaggg cagtcggcat
     1201 gtctacctcg ccgggatcgt ctccattggc agggagcact gcggccagaa gcaaatctcg
     1261 ggcatctaca ccagggtcag cggctacatg gactggatcg agagcaccat tcgggcgaat
     1321 cgcgtttgaa gacgtttcgt ttcagcctgt aactcagacc gaaaaccctt gaaaagcgat
     1381 taaagcgatt tttgaaatac ataaa