PREDICTED: Drosophila takahashii migration and invasion enhancer 1

LOCUS       XM_017157479             516 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068080), mRNA.
ACCESSION   XM_017157479
VERSION     XM_017157479.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157479.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..516
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..516
                     /gene="LOC108068080"
                     /note="migration and invasion enhancer 1; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 1 Protein"
                     /db_xref="GeneID:108068080"
     CDS             130..417
                     /gene="LOC108068080"
                     /codon_start=1
                     /product="migration and invasion enhancer 1"
                     /protein_id="XP_017012968.2"
                     /db_xref="GeneID:108068080"
                     /translation="MVKVEVEYCGICNFSGQCHLLRDFLLASSPDLDVSCRQGRRGSF
                     EVAIDGQLVHSKLSCLAFPQHASVLAQVHRAERGEPVEKVLEQPIKDCSVM"
     misc_feature    139..345
                     /gene="LOC108068080"
                     /note="selT/selW/selH selenoprotein domain; Region:
                     CXXU_selWTH; TIGR02174"
                     /db_xref="CDD:274013"
ORIGIN      
        1 taaaattttt tttaatttaa atatattttt ttaagtgcaa cgatagacga tagcgattat
       61 ttagcgacag ctgttgctga agcgctactt ttatttctgt tttgattact tttatgtaat
      121 ggtgaaagta tggtgaaagt ggaggtggaa tactgcggca tctgcaactt cagcggacag
      181 tgccacctgc tgcgcgactt cctgctggcc tcgtcgcccg acttggacgt atcctgccgc
      241 caaggacgcc gcggatcctt cgaggtggcc atcgacggcc agctggtgca ctcgaagctc
      301 tcctgcctgg cctttcccca gcacgccagt gtcctggccc aggtccacag ggcggagcgc
      361 ggagagcccg tcgagaaggt cctggagcag cccatcaagg actgcagtgt gatgtgatgg
      421 ttaattagcc cgtttacaaa cttagtctat tggaatgtgt taaatttaag gggaaaatcc
      481 gtgtgataag aggtttttcg aatgtaaata aaggat