Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Leucine-rich repeat-containing G


LOCUS       XM_017157466            2615 bp    mRNA    linear   INV 09-DEC-2024
            protein-coupled receptor 4 (Lgr4), mRNA.
ACCESSION   XM_017157466
VERSION     XM_017157466.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157466.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2615
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2615
                     /gene="Lgr4"
                     /note="Leucine-rich repeat-containing G protein-coupled
                     receptor 4; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins"
                     /db_xref="GeneID:108068072"
     CDS             231..2615
                     /gene="Lgr4"
                     /codon_start=1
                     /product="relaxin receptor 2"
                     /protein_id="XP_017012955.2"
                     /db_xref="GeneID:108068072"
                     /translation="MSIAIMRLPIVLSILLALTSNAAATGTATESTRTGIGTKPETEM
                     EVEAKEVISLLGAIDGIESVVLVPDSGDKCPGGYFHCNTTAQCVPQRANCDGTVDCDD
                     RSDELNCVNEVDAKYWDHLYRKQTFGTNDDLRIGECQWRNENFSCPCRGHEMLCRFQQ
                     LTVIPALLPQNDLVTLDLTGNNFETIHETFFSELPDMEILVLKFCSIREIASHAFDRL
                     ADSPLKTLYMDDNKLPHLPEHFFPEGNQLRILILARNRLHHLKRSDFRNLQQLEELDL
                     RGNRIGNFEAEVFAQLPSLEKLYLNENHLKRLDPERFPRTLLNLQTLSLDHNQIEDIA
                     ANTFPFPRLRHLYLAGNRLSHIRDETFCNLSNLQGLHLNENRIEGFDLEAFACLKNLS
                     SLLLTGNRFQTLDPRVLKNLSSLDYIYFSWFHLCSAAMSVRVCSPHGDGISSKLHLLD
                     NQILRGSVWVMASIAVVGNLLVLLGRYFYKSRSNVEHSLYLRHLAASDFLMGIYLTLI
                     ACADISFRGEYIKYEEAWRHSGICAFAGFLSTFSCQSSTLLLTLVTWDRLMSVTRPLK
                     PRDTEKVRIVLRLLLLWGISFGLAAAPLLPNPYFGSHFYGNNGVCLSLHIHDPYAKGW
                     EYSALLFILVNTLSLVFILFSYIRMLQAIRDSGGGMRSTHSGRENVVATRFAIIVTTD
                     CACWLPIIVVKVAALSGCDISPDLYAWLAVLVLPVNSALNPVLYTLTTAAFKQQLRRY
                     CHTLPSCSLVNNETRSQTQTAYESGLSVSLAHLGGGVGGGSGRKRMSHRQMSYL"
     misc_feature    450..557
                     /gene="Lgr4"
                     /note="Low Density Lipoprotein Receptor Class A domain, a
                     cysteine-rich repeat that plays a central role in
                     mammalian cholesterol metabolism; the receptor protein
                     binds LDL and transports it into cells by endocytosis; 7
                     successive cysteine-rich repeats of about...; Region:
                     LDLa; cd00112"
                     /db_xref="CDD:238060"
     misc_feature    order(465..467,492..494,525..530)
                     /gene="Lgr4"
                     /note="putative binding surface [active]"
                     /db_xref="CDD:238060"
     misc_feature    order(504..506,513..515,525..527,543..548)
                     /gene="Lgr4"
                     /note="calcium-binding site [ion binding]; other site"
                     /db_xref="CDD:238060"
     misc_feature    534..548
                     /gene="Lgr4"
                     /note="D-X-S-D-E motif; other site"
                     /db_xref="CDD:238060"
     misc_feature    687..>1475
                     /gene="Lgr4"
                     /note="Leucine-rich repeat (LRR) protein [Transcription];
                     Region: LRR; COG4886"
                     /db_xref="CDD:443914"
     misc_feature    747..818
                     /gene="Lgr4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    819..890
                     /gene="Lgr4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    897..968
                     /gene="Lgr4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    969..1040
                     /gene="Lgr4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1041..1112
                     /gene="Lgr4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1113..1187
                     /gene="Lgr4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1188..1256
                     /gene="Lgr4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1257..1328
                     /gene="Lgr4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1329..1400
                     /gene="Lgr4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1401..1466
                     /gene="Lgr4"
                     /note="leucine-rich repeat [structural motif]; Region:
                     leucine-rich repeat"
                     /db_xref="CDD:275380"
     misc_feature    1584..2441
                     /gene="Lgr4"
                     /note="relaxin family peptide receptors, member of the
                     class A family of seven-transmembrane G protein-coupled
                     receptors; Region: 7tmA_Relaxin_R; cd15137"
                     /db_xref="CDD:320265"
     misc_feature    1587..1667
                     /gene="Lgr4"
                     /note="TM helix 1 [structural motif]; Region: TM helix 1"
                     /db_xref="CDD:320265"
     misc_feature    1689..1766
                     /gene="Lgr4"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320265"
     misc_feature    order(1752..1754,1761..1766,1824..1841,1845..1850,
                     1857..1859,1989..1991,1995..2009,2097..2099,2106..2114,
                     2118..2126,2130..2135,2286..2288,2295..2300,2304..2309,
                     2316..2318,2340..2345,2349..2357,2364..2366,2373..2378)
                     /gene="Lgr4"
                     /note="putative peptide ligand binding pocket [polypeptide
                     binding]; other site"
                     /db_xref="CDD:320265"
     misc_feature    1824..1916
                     /gene="Lgr4"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320265"
     misc_feature    1947..2015
                     /gene="Lgr4"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320265"
     misc_feature    2097..2186
                     /gene="Lgr4"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320265"
     misc_feature    2226..2318
                     /gene="Lgr4"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320265"
     misc_feature    2343..2420
                     /gene="Lgr4"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320265"
ORIGIN      
        1 cagttgtttg ttatcgttgg caccgaacgc gcggcaccgc ggactgaaaa tcgggtcgac
       61 tgaaagtcga gtgatctact tgtatatttt tggatccccg aacgatctca cattgaagtg
      121 cggcgaagtt gtattttttt tttgcctttt ttttgccgtg cccatcgaag tctataatta
      181 aatattgttt attacccgtt aaatcggcgg aagagcggag aactccctgg atgtcaatag
      241 cgatcatgcg actccccatt gttctctcca tcctgctcgc actaacttct aatgcggcag
      301 cgacagggac ggcaacagaa agcacacgaa cgggaatcgg aacgaaaccg gaaacggaaa
      361 tggaggtgga agctaaggag gtgatatcgc tcctgggcgc aatcgatggc atcgagtccg
      421 ttgtcctggt tcccgactcc ggcgacaagt gtcccggcgg ctacttccac tgcaacacga
      481 cggcacaatg tgttccccag cgggccaact gcgacggaac cgtcgactgc gatgacagat
      541 cggatgagtt gaactgcgtg aatgaggtgg atgccaagta ctgggaccac ctgtacagga
      601 aacagacgtt cggcacgaac gacgacctgc ggattggcga gtgccagtgg cgcaacgaga
      661 actttagctg tccttgccga ggtcacgaaa tgttgtgccg ctttcaacag cttaccgtta
      721 ttccagcact tttgccgcag aacgatctgg taacgctcga tctaaccgga aacaatttcg
      781 aaaccattca cgagaccttc ttcagtgaac tgccagacat ggagatccta gtgctgaagt
      841 tctgctcaat ccgtgagatt gcctcgcatg ccttcgatcg cctggcggac agcccactga
      901 agacccttta tatggacgat aataaattgc cgcatctgcc ggaacacttc tttcccgagg
      961 gcaatcaatt gaggattcta attttggcac gcaaccgcct gcaccacctg aaacgcagtg
     1021 attttcgaaa tctacagcaa ctggaggagc tggacctgcg cggtaatcgc attggaaact
     1081 ttgaggccga ggtgtttgcc caactgccga gtttggaaaa gctctatctc aacgaaaacc
     1141 acttgaagcg actggatccc gaaagatttc ccagaaccct gctcaatctg cagactctgt
     1201 ccctggatca caatcagatc gaagatatag ccgccaacac atttcccttt ccgcgactta
     1261 gacatttata tttggctggc aatcgattat cccacatacg agatgaaacc ttttgcaatc
     1321 tcagcaatct acaaggatta cacttgaacg agaaccgcat cgagggattc gacctggagg
     1381 ccttcgcctg cctgaagaac ctcagctcgc tgctgctaac gggcaatcgc tttcagaccc
     1441 tcgatccgcg ggtcctaaaa aacctgagca gcctggatta tatttacttc tcgtggttcc
     1501 atttgtgtag cgccgccatg agtgtgcgag tctgttcccc acatggcgac ggcatcagca
     1561 gcaagttgca cctactggac aaccagatat tgagaggcag cgtttgggtg atggcctcaa
     1621 ttgccgtggt gggcaacctg ctggtcctgc tggggcgcta cttctacaag tcgcggagca
     1681 acgtggagca ctcgctctac ctccgccatt tggccgccag cgacttcctc atgggcattt
     1741 acctgacgct gattgcctgt gcggacatta gtttccgcgg cgagtacatc aaatacgagg
     1801 aggcctggcg gcacagcggc atttgcgcct tcgcaggctt cctcagcacc ttcagttgcc
     1861 agtcgtcgac gctgctgctc acactggtca cctgggatcg tctgatgtct gtgacgaggc
     1921 ccctgaagcc ccgagatacg gagaaagttc gaattgtcct ccgtctgttg ctcctgtggg
     1981 gcattagttt tggactggct gctgctccac tcctgcccaa tccctacttt ggcagccatt
     2041 tctatggcaa caacggtgtc tgcttgtccc tccacatcca cgatccctat gccaagggat
     2101 gggagtactc ggcgctactg ttcatcctgg tcaacacgtt gtcactggtc ttcatcctgt
     2161 tttcctacat acggatgttg caggcgatca gggattcggg cggcggaatg cggagcactc
     2221 acagcggccg cgagaatgtg gtggccactc gctttgccat cattgtgacc accgattgcg
     2281 cctgctggct gcccataatt gtggtcaaag tggctgccct ttcgggctgc gacatctccc
     2341 ccgatctgta tgcctggctg gccgtgctgg tgctgcccgt gaactcggcc ctcaatccgg
     2401 tgctctacac tctcaccacg gcggccttca agcagcagct gcgccgctac tgccacacgc
     2461 tgcccagctg ctcgctggtg aacaacgaga cccgatccca aacgcagacc gcctacgagt
     2521 ctggattgag cgtaagcctg gcccatttgg gtggcggagt gggcggcgga tcgggacgca
     2581 agcggatgtc ccaccgacag atgagctatc tgtag