PREDICTED: Drosophila takahashii fibrinogen-like protein A

LOCUS       XM_017157462             839 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068070), partial mRNA.
ACCESSION   XM_017157462
VERSION     XM_017157462.2
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Oct 18, 2021 this sequence version replaced XM_017157462.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
            COMPLETENESS: incomplete on the 5' end.
FEATURES             Location/Qualifiers
     source          1..839
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            <1..839
                     /gene="LOC108068070"
                     /note="fibrinogen-like protein A; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108068070"
     CDS             <1..723
                     /gene="LOC108068070"
                     /codon_start=1
                     /product="fibrinogen-like protein A"
                     /protein_id="XP_017012951.2"
                     /db_xref="GeneID:108068070"
                     /translation="IRTPRSLDIEPQLLGTGGAVPGSAGTPENCLKQQHGVVRIRPRA
                     NVEPFFVFCDQKVRNGGWTMVVNRYDGSEDFNRKWADYQIGFGPLTTEFFIGLDKLHQ
                     ITSSDNYELLVQLQNRKQELRYAVYDHFSIGSESEQYRLNVLGKYQGDAADALRQHTG
                     KKFSTHDRDNDESEANCAAQQSGAFWYGSSCNLSNPFGLYQRLLERDVDGFKGILWRG
                     FLDGPKGSLKIVRMLVRPRAVS"
     misc_feature    73..711
                     /gene="LOC108068070"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    418..420
                     /gene="LOC108068070"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(505..507,511..513,517..519)
                     /gene="LOC108068070"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(529..531,538..543,571..576)
                     /gene="LOC108068070"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
     polyA_site      839
                     /gene="LOC108068070"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attcgtaccc cccgcagctt ggatattgag ccacaactgc tgggcactgg tggcgcagtt
       61 cctggatccg ccgggactcc cgaaaactgc ctcaaacagc agcacggggt ggtgcgaatc
      121 cgaccgcgtg cgaatgtcga gcccttcttc gttttctgcg atcagaaagt gaggaacggc
      181 ggttggacca tggtggtaaa tcgctatgac ggcagcgagg acttcaatcg caagtgggcc
      241 gactatcaaa taggcttcgg ccctctgacc accgagttct ttatcggatt ggacaagcta
      301 catcagataa ccagtagcga taactacgag ctgctggtgc agctgcagaa caggaaacag
      361 gaactgcgct atgccgtcta cgatcacttc agcatcggca gtgagtcgga gcagtatcgc
      421 ctgaatgtcc tgggaaaata ccagggcgat gccgccgatg cactgcgtca gcacacgggc
      481 aagaagttca gcacccacga tcgggataat gacgaaagcg aggcgaattg tgcggcccag
      541 cagtcggggg ccttttggta tggcagttcc tgcaatctca gcaacccctt tggactctat
      601 caacgcctcc tagagcgaga tgtcgatggc ttcaaaggca tcttgtggcg cggtttcctc
      661 gacggaccca aaggctctct gaaaattgtt cgcatgctgg ttcgtccgcg ggctgtttca
      721 taaataggta ttcagtatat ttcaccagtc acactttaac aacaaaaaaa cacccaacag
      781 gttaaaaaaa aataaacaaa aattagaaat aaacataaaa taaattcgat ttagacttc