PREDICTED: Drosophila takahashii ryncolin-2 (LOC108068069), mRNA.

LOCUS       XM_017157461            1182 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017157461
VERSION     XM_017157461.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157461.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1182
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1182
                     /gene="LOC108068069"
                     /note="ryncolin-2; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 6 Proteins"
                     /db_xref="GeneID:108068069"
     CDS             104..1108
                     /gene="LOC108068069"
                     /codon_start=1
                     /product="ryncolin-2"
                     /protein_id="XP_017012950.2"
                     /db_xref="GeneID:108068069"
                     /translation="MALEALVTALACLSTTTNATSNLPGKHFSVIMRNSAEPFLLSEN
                     GTASCPVSTLGGLALRIQFMTNELQSLKSELNELQGLIEEYKNQGTGVPIATRLLRPL
                     PPSVQTFPLALATPTDDTPRNCHDEKHGQVRIRIAPDVEPFFASCDQKVRGGGWMVIA
                     YRYDGSEDFNKDWQNYKSGFGALNGEFFIGLDKLHRLTNSEHHELLIVMRNKNREERF
                     ALYDHFSIGSESEKYLLYVLGAYKGDAGDSLRYHAGKKFTTFDQDNDDNGQNCARTHA
                     GAWWYGRECFESNLFGTFQSKYGQEIGYFKGILWKTFLPGPTGSLSYVRMLIRPLKKS
                     "
     misc_feature    458..1096
                     /gene="LOC108068069"
                     /note="Fibrinogen-related domains (FReDs); C terminal
                     globular domain of fibrinogen. Fibrinogen is involved in
                     blood clotting, being activated by thrombin to assemble
                     into fibrin clots. The N-termini of 2 times 3 chains come
                     together to form a globular...; Region: FReD; cd00087"
                     /db_xref="CDD:238040"
     misc_feature    803..805
                     /gene="LOC108068069"
                     /note="gamma-gamma dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238040"
     misc_feature    order(890..892,896..898,902..904)
                     /gene="LOC108068069"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238040"
     misc_feature    order(914..916,923..928,956..961)
                     /gene="LOC108068069"
                     /note="polymerization pocket [active]"
                     /db_xref="CDD:238040"
     polyA_site      1182
                     /gene="LOC108068069"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 cgagcagttg caactgcgtt gcagtcgctg gcattcggaa ttcaggctgg aatcggaatc
       61 ggaatatata tatatatcga gaattatata ttattaaatc ggaatggcgc tggaggcgct
      121 cgtcacggct ttggcctgcc tcagcaccac cacaaatgcc acgagcaact tgccaggaaa
      181 acacttttcc gtgataatga gaaactcggc ggagcctttt cttctctctg aaaatggcac
      241 tgccagctgt cctgttagca ctttgggtgg cctagcactt cgcatacaat tcatgacgaa
      301 tgagctgcaa tctcttaaaa gtgaactcaa tgaactgcag ggacttatag aggaatataa
      361 aaatcagggc actggagtgc ccattgcaac cagattgctc cgcccattgc cgcccagtgt
      421 ccagaccttt cccctggccc tggccacgcc caccgatgat acgcccagga attgccatga
      481 cgagaagcac gggcaggtga ggatccggat tgcacccgat gtggaaccct tcttcgcgag
      541 ctgcgaccag aaggtgaggg gcggcggctg gatggtgatc gcctatcggt acgacggcag
      601 cgaggacttc aacaaggact ggcagaacta caagtcgggc tttggggccc ttaacgggga
      661 gttcttcatc ggcctggaca agttgcaccg cctgacgaac agcgagcacc acgagctgct
      721 catcgtgatg cgaaataaga atcgggagga gcgcttcgcc ctgtacgatc acttcagtat
      781 tggcagcgag tcggagaagt atcttctgta tgtcctgggc gcctacaagg gcgatgcggg
      841 cgattcgctg cgctatcatg cgggcaagaa gttcaccacc ttcgatcagg acaacgatga
      901 taatggccag aactgcgcca ggactcacgc gggtgcctgg tggtacggaa gggagtgctt
      961 cgagagcaac ctctttggca ccttccagtc gaagtacggc caggagattg gctacttcaa
     1021 gggcatcctg tggaagacct tcctgccagg acccaccggc tccctcagct acgtccgcat
     1081 gctcatccgg ccgctcaaga agtcgtaggg gccgcactaa acacaagact ccttagccat
     1141 ataaacacac atagactaca ataaatgtcg attatttagt aa