Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii RhoU (RhoU), mRNA.


LOCUS       XM_017157458            2657 bp    mRNA    linear   INV 09-DEC-2024
ACCESSION   XM_017157458
VERSION     XM_017157458.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157458.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..2657
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..2657
                     /gene="RhoU"
                     /note="RhoU; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins"
                     /db_xref="GeneID:108068065"
     CDS             482..2206
                     /gene="RhoU"
                     /codon_start=1
                     /product="uncharacterized protein RhoU"
                     /protein_id="XP_017012947.3"
                     /db_xref="GeneID:108068065"
                     /translation="MTVKLAKLFGSGVEVLDQQQQQQEQHIQQQQQQPLVAQQQQPPP
                     LPPPNANMKSLKYYEHLQATYDCHLMDHDQDQDQDQDDYEDTCMQRNHPYNNSQRPLL
                     GDRRPQLTVMSVVKKGGGGGGGKAGVPLPPLPPLRSYISPYVQQQKRDSAKGLHGFND
                     FDALSQQYNQHLQSSPHIGYPYGSPPSPTAQSSDFCFDRQTTGLVRGTSASVGNQHQV
                     ISSSSSNCSSSHTTSTSSPTRYYPDNSGNIASLYPSRFEDDFCMRRPVVQLDGSPGGG
                     GGVGVAGGPFIFGIAPEEQLTDYGSNPLPPTPPQLKQQQSVISRSPLQQSLSDTSAAS
                     SGKGSKFLLRKRKSKKTTAAAATTTTTAAAEAATTAKKGGKKDAAPSQPSIKCVLVGD
                     GAVGKTNLILSYLENRFNTEHIPTASDIYNADVNVNESPVHLTICDTAGQDTLDPLRE
                     LCYPDSDVFLLCFSVVKPETFRAIKAKWAPKFAKTKAALILVGTQADLRTSPNVLNKL
                     QTNGEKAISYADAWDLATTIGAKYIETSSATQDKVKDVFDTAIWEGLVPTTLPPTPSF
                     WRKLFCLA"
     misc_feature    1634..2143
                     /gene="RhoU"
                     /note="Wnt-1 responsive Cdc42 homolog (Wrch-1) is a Rho
                     family GTPase similar to Cdc42; Region: Wrch_1; cd04130"
                     /db_xref="CDD:133330"
     misc_feature    order(1637..1639,1727..1732,1736..1741,1745..1747,
                     1751..1753,1778..1780,1790..1795,1799..1807,1823..1825,
                     1832..1834)
                     /gene="RhoU"
                     /note="putative GEF (guanine nucleotide exchange factor)
                     interaction site [polypeptide binding]; other site"
                     /db_xref="CDD:133330"
     misc_feature    1652..1675
                     /gene="RhoU"
                     /note="G1 box; other site"
                     /db_xref="CDD:133330"
     misc_feature    order(1661..1678,1793..1798,1802..1804,1964..1966,
                     1970..1972,2090..2095)
                     /gene="RhoU"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133330"
     misc_feature    1724..1744
                     /gene="RhoU"
                     /note="Switch I region; other site"
                     /db_xref="CDD:133330"
     misc_feature    1727..1729
                     /gene="RhoU"
                     /note="G2 box; other site"
                     /db_xref="CDD:133330"
     misc_feature    order(1730..1732,1799..1801,1823..1825,1829..1831)
                     /gene="RhoU"
                     /note="putative GDI (guanine nucleotide dissociation
                     inhibitor) interaction [active]"
                     /db_xref="CDD:133330"
     misc_feature    order(1730..1735,1805..1807,1823..1825)
                     /gene="RhoU"
                     /note="putative GAP (GTPase-activating protein)
                     interaction site [polypeptide binding]; other site"
                     /db_xref="CDD:133330"
     misc_feature    order(1733..1738,1823..1825,1832..1834)
                     /gene="RhoU"
                     /note="putative effector interaction site [active]"
                     /db_xref="CDD:133330"
     misc_feature    1793..1804
                     /gene="RhoU"
                     /note="G3 box; other site"
                     /db_xref="CDD:133330"
     misc_feature    order(1802..1807,1823..1834,1847..1855)
                     /gene="RhoU"
                     /note="Switch II region; other site"
                     /db_xref="CDD:133330"
     misc_feature    1961..1972
                     /gene="RhoU"
                     /note="G4 box; other site"
                     /db_xref="CDD:133330"
     misc_feature    2087..2095
                     /gene="RhoU"
                     /note="G5 box; other site"
                     /db_xref="CDD:133330"
ORIGIN      
        1 tgtatcttgt tttcgatcgt cgattctcgt ttgcggttgc ctcgtttttc gctccgcttc
       61 gttgttgttt ttgttatccg tcggtttctt ttagcggagt ttgttttcgg ttttcgatta
      121 agttctgttt tcgctttttt tttctgtgcc ccgagttgca cgcaggcgca acagcaaaat
      181 aagaggagaa acagcgaaaa tcgttgttgc aagtggctgc gttctccgac gtcgacggcg
      241 cagcggcgca ggcgcaacag cagcggaaca acgaatcaaa tggaattgga tttcgcctca
      301 acgaacaatt aattggaatt acatttcaac tggaagtgag ttgccttaat ttggaggaag
      361 gaaaattgaa ttggctacac aaactggtgg aaacttttcc ccacagcaac tgtcattgtc
      421 ttttggcatt gggcaacatt ttaattgaaa aagtttctgg cgagagcagc gaagagaaga
      481 gatgactgtg aaattggcca agctgtttgg gtctggagtc gaggtcctgg accagcagca
      541 gcagcaacag gagcaacata tccagcagca acagcaacaa ccgctggtag cacagcagca
      601 gcaaccgccg cctctgccgc ctccaaatgc gaatatgaag agcctcaagt attacgagca
      661 tctgcaggcc acctacgact gccatctgat ggatcacgac caggatcagg atcaggatca
      721 ggacgactac gaggacacct gcatgcagcg caatcatccg tacaacaatt cacagcgacc
      781 cctgctgggg gatcggcgac cccagctgac ggtgatgagt gtggtgaaaa aggggggtgg
      841 tggcggcggt ggcaaggcgg gggtgccact gccccctctg ccgcccctga ggagctacat
      901 ctcaccctat gtgcagcaac agaagcggga cagtgccaag gggctgcacg ggttcaacga
      961 tttcgatgcc ctttcgcagc agtataatca gcatttgcag agcagtccgc acatcggcta
     1021 tccctacggc agtcccccct cgccgacggc tcagtcgagt gacttctgct tcgatcgaca
     1081 gacgacggga ttggtcaggg gaacctccgc ctcggtgggc aatcagcatc aggtcatctc
     1141 gagcagctcg agcaactgca gcagctcgca caccacatcc acctcctcgc ccacccgtta
     1201 ttatccggat aattcgggga atatcgccag cctgtatcct agccgtttcg aggatgattt
     1261 ttgcatgcgt cgtcctgtcg tccagttgga tgggtcgcca ggaggaggag gtggagtggg
     1321 agtagcaggt ggacccttca tctttggcat tgccccggag gaacagttga cggactatgg
     1381 aagcaatcca ctgccaccga cgccgccgca gctgaagcaa caacaatctg tgattagccg
     1441 aagtcccttg caacaatcgc tgagcgacac aagtgccgcc agtagtggca agggctccaa
     1501 attcttactg cgtaagcgta aatcaaagaa gacaaccgca gcagccgcaa caacaacaac
     1561 aacggcagca gctgaggccg caacaacggc caaaaagggt ggcaaaaagg atgctgcccc
     1621 ctcacagccg tcgatcaagt gcgttttggt gggtgacggg gccgtgggca agacgaatct
     1681 gatcctgtcg tatctggaga accgcttcaa cacggagcac atacccacgg cctcggacat
     1741 ttacaatgcc gatgtgaatg tgaacgagag tccggtgcac ctgaccattt gtgataccgc
     1801 cggccaggac accctggatc cgctgaggga gctctgctat ccggacagcg acgtcttcct
     1861 gctctgcttc tcggtggtga agccggaaac gtttcgggcc atcaaggcca aatgggcgcc
     1921 caagtttgcc aagaccaagg ccgccctgat tttggttggc acccaggccg atcttcgcac
     1981 cagcccgaat gtcctcaaca aactgcagac aaatggcgag aaagcaattt catatgcaga
     2041 cgcctgggat ttggcaacaa caattggcgc aaaatacatt gagacttcgt cagccacaca
     2101 ggacaaagtc aaggatgtgt tcgacacagc catttgggag ggcctcgtgc ccaccaccct
     2161 gccgcccacg ccctccttct ggaggaagct cttctgcctg gcctgaaact cgaaactgaa
     2221 gatcaaccca actctcaaca cacactcgat ttattataat ttttattttt tttggatata
     2281 taaccattat ttatattaaa gatttttttt agagattttc gtttagcagt gcttgcacac
     2341 agactgatct acacataaac taaagtaaca tatacattta gattttaaac aagaaaatta
     2401 taatgcttaa tgcctaatcg tatagatttc atcactttac tcgtaaacat gttcgtggtt
     2461 ttctctcatc gccttctttt ttgttttatt ataaaaccta aactatttaa gccttattat
     2521 cgcccagatc cacaactatg ttacatcatt ccatccattt ttaagcatta cgttttaagc
     2581 aaatatttca aatattgtat atcgaaggca gcagtaaata tagtagcaaa acaaatccac
     2641 caattctgga ttgaatt