Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157432 727 bp mRNA linear INV 09-DEC-2024 (LOC108068053), mRNA. ACCESSION XM_017157432 VERSION XM_017157432.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157432.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..727 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..727 /gene="LOC108068053" /note="transcription factor 15; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108068053" CDS 52..501 /gene="LOC108068053" /codon_start=1 /product="transcription factor 15" /protein_id="XP_017012921.2" /db_xref="GeneID:108068053" /translation="MAVASSSSSSYLMAVFAQDSNSSGSASGSGCSGAAADSEDSLMG QEIGQGSHQGSHRRRPPRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEII RLASSYITHLSSTLETGTECQPCLLHKYENEGITRRISICTFCLKTK" misc_feature 235..399 /gene="LOC108068053" /note="basic helix-loop-helix (bHLH) domain found in scleraxis, transcription factor 15 (TCF-15) and similar proteins; Region: bHLH_TS_scleraxis_like; cd11465" /db_xref="CDD:381471" misc_feature order(235..237,247..249,253..261,265..267,280..282, 334..345) /gene="LOC108068053" /note="putative DNA binding site [nucleotide binding]; other site" /db_xref="CDD:381471" misc_feature order(274..279,286..291,295..300,346..348,355..357, 367..369,373..378,388..390,394..399) /gene="LOC108068053" /note="putative dimer interface [polypeptide binding]; other site" /db_xref="CDD:381471" polyA_site 727 /gene="LOC108068053" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 gaatcggtca gggaatccgt tcagttgctc tcaaatcgct gccttcgacg gatggcggtc 61 gcatcatcat catcatcatc gtatttgatg gctgtgtttg cccaggatag taacagtagt 121 ggcagtgcca gcggcagtgg atgcagtggg gcagccgccg attccgagga ctccctgatg 181 ggccaggaga tcggccaggg gagtcatcag gggagccaca ggagacgacc gccgcgccaa 241 aagatcaacg ccagggagcg ctacaggaca ttcaatgtaa attccgccta cgaagcacta 301 agaaatttaa tacccacgga acccatgaat cgaaagctct caaagatcga gattatccgc 361 ctggccagca gctatataac gcatcttagt agcacccttg aaacaggaac tgaatgccag 421 ccatgtttgc tacacaaata cgagaacgaa ggaatcacca ggcgaatcag catctgcacc 481 ttctgcctga aaaccaaatg aaattattga taacctgaac atttctttat ttttttatat 541 ttttttgtcg tatttattgc atttgaaaat ctattttaaa atttgcgcct aagtgcagcg 601 ccatctattc taatcttctg gaactttgaa agtgaactgc ttgctgaact gcttttcggc 661 acattattat tattcgatct cgttatgtat ataaaaataa ataaaataaa caatataatt 721 tattcaa