Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii transcription factor 15


LOCUS       XM_017157432             727 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068053), mRNA.
ACCESSION   XM_017157432
VERSION     XM_017157432.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157432.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..727
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..727
                     /gene="LOC108068053"
                     /note="transcription factor 15; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108068053"
     CDS             52..501
                     /gene="LOC108068053"
                     /codon_start=1
                     /product="transcription factor 15"
                     /protein_id="XP_017012921.2"
                     /db_xref="GeneID:108068053"
                     /translation="MAVASSSSSSYLMAVFAQDSNSSGSASGSGCSGAAADSEDSLMG
                     QEIGQGSHQGSHRRRPPRQKINARERYRTFNVNSAYEALRNLIPTEPMNRKLSKIEII
                     RLASSYITHLSSTLETGTECQPCLLHKYENEGITRRISICTFCLKTK"
     misc_feature    235..399
                     /gene="LOC108068053"
                     /note="basic helix-loop-helix (bHLH) domain found in
                     scleraxis, transcription factor 15 (TCF-15) and similar
                     proteins; Region: bHLH_TS_scleraxis_like; cd11465"
                     /db_xref="CDD:381471"
     misc_feature    order(235..237,247..249,253..261,265..267,280..282,
                     334..345)
                     /gene="LOC108068053"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:381471"
     misc_feature    order(274..279,286..291,295..300,346..348,355..357,
                     367..369,373..378,388..390,394..399)
                     /gene="LOC108068053"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:381471"
     polyA_site      727
                     /gene="LOC108068053"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 gaatcggtca gggaatccgt tcagttgctc tcaaatcgct gccttcgacg gatggcggtc
       61 gcatcatcat catcatcatc gtatttgatg gctgtgtttg cccaggatag taacagtagt
      121 ggcagtgcca gcggcagtgg atgcagtggg gcagccgccg attccgagga ctccctgatg
      181 ggccaggaga tcggccaggg gagtcatcag gggagccaca ggagacgacc gccgcgccaa
      241 aagatcaacg ccagggagcg ctacaggaca ttcaatgtaa attccgccta cgaagcacta
      301 agaaatttaa tacccacgga acccatgaat cgaaagctct caaagatcga gattatccgc
      361 ctggccagca gctatataac gcatcttagt agcacccttg aaacaggaac tgaatgccag
      421 ccatgtttgc tacacaaata cgagaacgaa ggaatcacca ggcgaatcag catctgcacc
      481 ttctgcctga aaaccaaatg aaattattga taacctgaac atttctttat ttttttatat
      541 ttttttgtcg tatttattgc atttgaaaat ctattttaaa atttgcgcct aagtgcagcg
      601 ccatctattc taatcttctg gaactttgaa agtgaactgc ttgctgaact gcttttcggc
      661 acattattat tattcgatct cgttatgtat ataaaaataa ataaaataaa caatataatt
      721 tattcaa