Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157360 1083 bp mRNA linear INV 09-DEC-2024 4-like (COX4L), mRNA. ACCESSION XM_017157360 VERSION XM_017157360.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157360.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1083 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1083 /gene="COX4L" /note="Cytochrome c oxidase subunit 4-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108068020" CDS 152..712 /gene="COX4L" /codon_start=1 /product="cytochrome c oxidase subunit 4 isoform 1, mitochondrial" /protein_id="XP_017012849.2" /db_xref="GeneID:108068020" /translation="MSALRLIPRCKARNLGQMSTSLMSMGRRFASGGGDGIRLLIGDR EVVGYGINGRPLYFDSQDCPFPAIRYREVTPELCAIREKELGDWKKLSLEDKKQLYRH SFCQTYAEFQHFSPEWKICLGVALWLVAIGFGVTIAMKTKMYAELPDTFDDEHQSAQL RRMIQLQMNPVTGISSKWCYHENKWK" misc_feature 284..691 /gene="COX4L" /note="Cytochrome c oxidase subunit IV. Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of...; Region: Cyt_c_Oxidase_IV; cd00922" /db_xref="CDD:238462" misc_feature order(296..298,542..544,575..577) /gene="COX4L" /note="Subunit IV/VIIIb interface [polypeptide binding]; other site" /db_xref="CDD:238462" misc_feature 308..310 /gene="COX4L" /note="Subunit IV/Vb interface [polypeptide binding]; other site" /db_xref="CDD:238462" misc_feature order(326..328,332..334,338..349,401..403,407..409, 413..415,437..439,449..454,458..463,467..478,485..487) /gene="COX4L" /note="Subunit IV/Va interface [polypeptide binding]; other site" /db_xref="CDD:238462" misc_feature order(329..337,500..502,521..523,533..535,545..547, 557..559,584..586,590..592,599..604) /gene="COX4L" /note="Subunit IV/I interface [polypeptide binding]; other site" /db_xref="CDD:238462" misc_feature order(332..334,635..640,647..649,659..661,665..673) /gene="COX4L" /note="Subunit IV/II interface [polypeptide binding]; other site" /db_xref="CDD:238462" misc_feature order(332..334,488..490,494..496,500..505) /gene="COX4L" /note="putative ATP/ADP binding site [chemical binding]; other site" /db_xref="CDD:238462" misc_feature order(506..511,527..532,536..544,548..553,602..604, 611..613,620..625,632..634,644..646,671..673,683..685) /gene="COX4L" /note="Subunit IV/VIIb interface [polypeptide binding]; other site" /db_xref="CDD:238462" misc_feature order(650..652,665..667) /gene="COX4L" /note="Subunit IV/VIc interface [polypeptide binding]; other site" /db_xref="CDD:238462" polyA_site 1083 /gene="COX4L" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 ttttatggcc tcaaaagttt tcattatacc tacagggcga gcacttttca tttgcctgcg 61 acacaggcaa cgaactggtc gtatttcgag agcaagttgt acaaaaaaaa atccaaatta 121 aaaagtgtga aaaaagtaca gtgccgtcaa aatgtcggca ctgcgcttga ttcctcgctg 181 caaggcgagg aatctgggcc agatgtcgac ttcgctgatg tcgatgggtc gtcgatttgc 241 cagcggcggc ggcgatggca ttcgcctgct catcggcgat cgtgaggtgg ttggctatgg 301 gatcaacgga cgacccctgt acttcgatag ccaggactgc ccgtttccgg ccatccgata 361 tcgcgaagtc accccggagc tgtgcgccat acgcgaaaag gagctgggcg actggaagaa 421 gctgtcgctg gaggacaaga agcagctgta tcgccacagc ttttgccaaa cctacgcgga 481 attccagcac ttttcgcccg aatggaagat ctgcctgggc gtcgccctgt ggctggtggc 541 cattggattc ggcgtgacga tcgccatgaa gaccaagatg tatgccgagc tgcccgacac 601 gttcgacgat gaacaccagt cggcccagct gcgccgcatg atccagctgc agatgaatcc 661 cgtcacgggg atttcatcca agtggtgcta ccacgagaac aagtggaagt agccctctac 721 acaattgatt tgccgtatgc tatgtacaga aacgtagcaa gcaacacatg aatttcacac 781 taactacact atcaacagcg acatcggttg ccaatcgatc gatcagatat tgccaaacga 841 aatcatttct ctcacactat agctacacat acaatgctct cacactatag ctagacatac 901 aatgctctca cactatggct acacatatat gctcgttaca cgttactcga ctgccagcta 961 gtcgtatttt aacacttact aaacctacaa ctaggttaac aaaaaaaacg aataacaaaa 1021 aaaaaagaac gagaggcgac actccacact cgactgccaa ctaacacatt tccttagtta 1081 tta