Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii Cytochrome c oxidase subunit


LOCUS       XM_017157360            1083 bp    mRNA    linear   INV 09-DEC-2024
            4-like (COX4L), mRNA.
ACCESSION   XM_017157360
VERSION     XM_017157360.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157360.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1083
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1083
                     /gene="COX4L"
                     /note="Cytochrome c oxidase subunit 4-like; Derived by
                     automated computational analysis using gene prediction
                     method: Gnomon. Supporting evidence includes similarity
                     to: 4 Proteins"
                     /db_xref="GeneID:108068020"
     CDS             152..712
                     /gene="COX4L"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 4 isoform 1,
                     mitochondrial"
                     /protein_id="XP_017012849.2"
                     /db_xref="GeneID:108068020"
                     /translation="MSALRLIPRCKARNLGQMSTSLMSMGRRFASGGGDGIRLLIGDR
                     EVVGYGINGRPLYFDSQDCPFPAIRYREVTPELCAIREKELGDWKKLSLEDKKQLYRH
                     SFCQTYAEFQHFSPEWKICLGVALWLVAIGFGVTIAMKTKMYAELPDTFDDEHQSAQL
                     RRMIQLQMNPVTGISSKWCYHENKWK"
     misc_feature    284..691
                     /gene="COX4L"
                     /note="Cytochrome c oxidase subunit IV. Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_IV; cd00922"
                     /db_xref="CDD:238462"
     misc_feature    order(296..298,542..544,575..577)
                     /gene="COX4L"
                     /note="Subunit IV/VIIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238462"
     misc_feature    308..310
                     /gene="COX4L"
                     /note="Subunit IV/Vb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238462"
     misc_feature    order(326..328,332..334,338..349,401..403,407..409,
                     413..415,437..439,449..454,458..463,467..478,485..487)
                     /gene="COX4L"
                     /note="Subunit IV/Va interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238462"
     misc_feature    order(329..337,500..502,521..523,533..535,545..547,
                     557..559,584..586,590..592,599..604)
                     /gene="COX4L"
                     /note="Subunit IV/I interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238462"
     misc_feature    order(332..334,635..640,647..649,659..661,665..673)
                     /gene="COX4L"
                     /note="Subunit IV/II interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238462"
     misc_feature    order(332..334,488..490,494..496,500..505)
                     /gene="COX4L"
                     /note="putative ATP/ADP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238462"
     misc_feature    order(506..511,527..532,536..544,548..553,602..604,
                     611..613,620..625,632..634,644..646,671..673,683..685)
                     /gene="COX4L"
                     /note="Subunit IV/VIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238462"
     misc_feature    order(650..652,665..667)
                     /gene="COX4L"
                     /note="Subunit IV/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238462"
     polyA_site      1083
                     /gene="COX4L"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 ttttatggcc tcaaaagttt tcattatacc tacagggcga gcacttttca tttgcctgcg
       61 acacaggcaa cgaactggtc gtatttcgag agcaagttgt acaaaaaaaa atccaaatta
      121 aaaagtgtga aaaaagtaca gtgccgtcaa aatgtcggca ctgcgcttga ttcctcgctg
      181 caaggcgagg aatctgggcc agatgtcgac ttcgctgatg tcgatgggtc gtcgatttgc
      241 cagcggcggc ggcgatggca ttcgcctgct catcggcgat cgtgaggtgg ttggctatgg
      301 gatcaacgga cgacccctgt acttcgatag ccaggactgc ccgtttccgg ccatccgata
      361 tcgcgaagtc accccggagc tgtgcgccat acgcgaaaag gagctgggcg actggaagaa
      421 gctgtcgctg gaggacaaga agcagctgta tcgccacagc ttttgccaaa cctacgcgga
      481 attccagcac ttttcgcccg aatggaagat ctgcctgggc gtcgccctgt ggctggtggc
      541 cattggattc ggcgtgacga tcgccatgaa gaccaagatg tatgccgagc tgcccgacac
      601 gttcgacgat gaacaccagt cggcccagct gcgccgcatg atccagctgc agatgaatcc
      661 cgtcacgggg atttcatcca agtggtgcta ccacgagaac aagtggaagt agccctctac
      721 acaattgatt tgccgtatgc tatgtacaga aacgtagcaa gcaacacatg aatttcacac
      781 taactacact atcaacagcg acatcggttg ccaatcgatc gatcagatat tgccaaacga
      841 aatcatttct ctcacactat agctacacat acaatgctct cacactatag ctagacatac
      901 aatgctctca cactatggct acacatatat gctcgttaca cgttactcga ctgccagcta
      961 gtcgtatttt aacacttact aaacctacaa ctaggttaac aaaaaaaacg aataacaaaa
     1021 aaaaaagaac gagaggcgac actccacact cgactgccaa ctaacacatt tccttagtta
     1081 tta