Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157352 1008 bp mRNA linear INV 09-DEC-2024 necrosis factor-alpha factor homolog (LOC108068011), mRNA. ACCESSION XM_017157352 VERSION XM_017157352.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157352.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1008 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1008 /gene="LOC108068011" /note="lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108068011" CDS 7..492 /gene="LOC108068011" /codon_start=1 /product="lipopolysaccharide-induced tumor necrosis factor-alpha factor homolog" /protein_id="XP_017012841.2" /db_xref="GeneID:108068011" /translation="MAEEKHRMLYQGQDPSQQDQLNHQDQPKQRPLSLSPSEPPTYDD AMNRLEEEEEVYSQVEEGSSEELTAPPERNFFIVAPQPKLGSQAMDIVCLACGQRGFT RLKSSPNKRTNIFALWLCILGWCCCACLCPYFWNCCRTTNHYCSACDIFLGAHYPTEC C" misc_feature 277..471 /gene="LOC108068011" /note="LITAF-like zinc ribbon domain; Region: zf-LITAF-like; pfam10601" /db_xref="CDD:463165" ORIGIN 1 tttgccatgg ccgaggagaa gcaccgtatg ttgtaccagg gtcaggatcc cagccagcag 61 gatcagctga atcaccagga tcagccgaag cagcgacctt tgtccctgtc cccctcggaa 121 ccgcccacct atgatgatgc catgaatcgc ctggaggagg aggaagaggt gtactcccaa 181 gtggaggagg gttcatcgga ggaattgaca gcgccgccag agcgaaattt cttcattgtg 241 gcccctcaac ccaaattggg cagccaggcg atggacatcg tttgtctagc ttgtggccaa 301 cggggattca ctcgcttgaa gagctcacca aataagcgca ccaacatttt tgccctctgg 361 ctgtgcattt tgggttggtg ctgctgcgcc tgtttgtgtc cttatttttg gaactgctgc 421 cggacgacga atcattactg ctccgcctgc gatatcttcc tgggcgcaca ttatcccact 481 gaatgctgct gacggtagtc cgaggtccgg aaatatatcc tccaggatcg cagcctgaat 541 ccggccgcta attgtgaaag ttttccgtgt gtgaataaag ctgagtgggc ggcacgctgc 601 tgctgctgtt gctgcttctg accacaagga ctcggggctt attcgcttgt aatgagtaac 661 agagccgagc gcggccggaa attgtgcgcc gtcaaatcga attgcctacc taagcccatc 721 gtccgtcgtt cgtcgtccat cgtccttggt tttcaatccc ctcccactaa aatccagcgc 781 ccacaggcca tcaccatttt catgcccctc cgcccaaatg atgcataact ggcctaaaca 841 aattgcctca tcatcactcc ggctcgcaca tcctgccacc aagagcggat tgttgttgat 901 gctgctcgtt attgacaccc tgcaaaacgg ggtatattgg gttttaaaat attttcaata 961 ttgaaaaaaa aatctaaaaa aataatggaa gtagatttaa attgaatt