Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii protein Loquacious-like


LOCUS       XM_017157349            1083 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068009), mRNA.
ACCESSION   XM_017157349
VERSION     XM_017157349.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157349.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1083
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1083
                     /gene="LOC108068009"
                     /note="protein Loquacious-like; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon."
                     /db_xref="GeneID:108068009"
     CDS             82..1083
                     /gene="LOC108068009"
                     /codon_start=1
                     /product="protein Loquacious-like"
                     /protein_id="XP_017012838.2"
                     /db_xref="GeneID:108068009"
                     /translation="MDQKKTQDPKEDHGHSTGGEVKEESLPNPDFKATEEELRFLREA
                     SASKQPVALLQELLSRRSLVPTYELLQTEGSGAEVNFWFRVFFKDKEVTHFAVGSGRS
                     KKIGKHEAARLLIETLTGTPNGGSNRQNTLEIVDEHSIRDLNEICVKRRWASPVYESE
                     DRMLEEKQHRVICLVQEFSEVGTGWTRKAAKRMAAQKMCTRLLGNSGEPKDHGEPKNQ
                     ASQQSQKSPKAPMGPKMMGLRKTCLKSTKIDFKKLLTEIAVENQFEVTYVDIEETTFS
                     KQFQCLVLICMAPVGVCHGSGASMEEARREAARNGLEYLKMIILGGESIEEAIAKLN"
     misc_feature    223..441
                     /gene="LOC108068009"
                     /note="double-stranded RNA binding motif (DSRM)
                     superfamily; Region: DSRM_SF; cl00054"
                     /db_xref="CDD:444671"
     misc_feature    order(244..249,253..255,322..324,385..393,400..402)
                     /gene="LOC108068009"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:380679"
     misc_feature    493..687
                     /gene="LOC108068009"
                     /note="double-stranded RNA binding motif (DSRM)
                     superfamily; Region: DSRM_SF; cl00054"
                     /db_xref="CDD:444671"
     misc_feature    order(511..516,520..522,586..588,637..645,652..654)
                     /gene="LOC108068009"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:380679"
     misc_feature    826..1029
                     /gene="LOC108068009"
                     /note="third double-stranded RNA binding motif of PRKRA,
                     TARBP2 and similar proteins; Region: DSRM_PRKRA-like_rpt3;
                     cd19864"
                     /db_xref="CDD:380693"
     misc_feature    order(826..828,832..837,844..849,856..861,880..882,
                     910..918,922..924,928..930,973..984,991..993)
                     /gene="LOC108068009"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:380693"
     misc_feature    order(862..864,895..903,919..927,931..933,937..945,
                     949..957,961..966,1009..1011,1018..1023)
                     /gene="LOC108068009"
                     /note="Dicer interface [polypeptide binding]; other site"
                     /db_xref="CDD:380693"
ORIGIN      
        1 tttttttgta aagctgtcaa tgcattcgat caaaaatcga acgacgactg tatctttaat
       61 taataaaaga gccacggaaa tatggatcaa aagaaaacac aagatcctaa ggaggatcat
      121 ggccactcca ctggtggaga ggtaaaagag gaaagtttgc ccaatccgga cttcaaggcc
      181 accgaagagg agctgaggtt ccttcgcgag gccagcgcct caaaacaacc cgttgccctg
      241 ctgcaggagt tgctatcccg ccgcagcctc gttcccacct acgagctgct ccagaccgag
      301 ggatccggtg ccgaggtgaa cttctggttt cgcgtcttct tcaaggacaa ggaagtcact
      361 cacttcgccg ttggttccgg gcgctccaaa aaaattggca agcatgaggc tgctcggctg
      421 ctcatcgaaa ccctgactgg aacacccaac ggtggttcca atcgtcaaaa tactttagaa
      481 atcgtcgatg agcattcgat ccgcgatctg aacgagatct gcgtgaaacg ccgctgggct
      541 tccccggttt acgaatcaga ggacaggatg ctcgaggaga agcagcacag ggtcatttgc
      601 ctggtccagg agttcagcga ggtgggcacg ggatggacca ggaaggcggc caagcggatg
      661 gccgcccaga aaatgtgcac tcgcctactg gggaattctg gtgaaccgaa ggatcatggt
      721 gaaccgaaaa accaggcatc gcagcaatcg cagaagagcc caaaagctcc aatgggacca
      781 aaaatgatgg gcctacggaa gacctgcctg aagagcacca agattgactt caagaaactg
      841 ctgaccgaga tcgctgtgga gaatcaattt gaggtcacct acgtggacat cgaggagacc
      901 accttctcca agcagtttca gtgcctggtc ctcatctgca tggcgccagt gggcgtctgt
      961 cacggcagtg gtgcgtcgat ggaggaagct cggagggagg ccgccaggaa tggccttgaa
     1021 tacctgaaga tgatcatcct tggtggcgag agtattgaag aagcgattgc caagctcaac
     1081 tga