Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157348 412 bp mRNA linear INV 09-DEC-2024 (LOC108068008), mRNA. ACCESSION XM_017157348 VERSION XM_017157348.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157348.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..412 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..412 /gene="LOC108068008" /note="uncharacterized LOC108068008; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein" /db_xref="GeneID:108068008" CDS 172..348 /gene="LOC108068008" /codon_start=1 /product="uncharacterized protein" /protein_id="XP_017012837.2" /db_xref="GeneID:108068008" /translation="MVEKKKSLQLLRMVRSSLKIIYNDHFCWTFIKSYGLFSLAIPLA KYLDGFQILPNGGI" polyA_site 412 /gene="LOC108068008" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 attttccttt aaacctagtt accctggcga aatcagtgtt tccgtctcgt gccattcgac 61 cagttctgtt tcatttcgtt tttggagagc acacacatct gaatttttgt tggaaaaaaa 121 atctatatag tttttattcc catcgattcg aggaatctct tttctggcgc tatggtggag 181 aaaaagaaat cgcttcagct gctgcgaatg gtgcgctctt ccctgaaaat catctacaac 241 gatcacttct gttggacctt catcaagagc tatgggctct tctccttggc catcccgctg 301 gccaagtacc ttgatggctt ccaaatattg cccaacgggg gcatctaatt ctttgttcta 361 atatacgtaa attacatgtt gattgaacaa ggcaaccagt cgaactgtaa aa