Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017157348             412 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108068008), mRNA.
ACCESSION   XM_017157348
VERSION     XM_017157348.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157348.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..412
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..412
                     /gene="LOC108068008"
                     /note="uncharacterized LOC108068008; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 1
                     Protein"
                     /db_xref="GeneID:108068008"
     CDS             172..348
                     /gene="LOC108068008"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_017012837.2"
                     /db_xref="GeneID:108068008"
                     /translation="MVEKKKSLQLLRMVRSSLKIIYNDHFCWTFIKSYGLFSLAIPLA
                     KYLDGFQILPNGGI"
     polyA_site      412
                     /gene="LOC108068008"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 attttccttt aaacctagtt accctggcga aatcagtgtt tccgtctcgt gccattcgac
       61 cagttctgtt tcatttcgtt tttggagagc acacacatct gaatttttgt tggaaaaaaa
      121 atctatatag tttttattcc catcgattcg aggaatctct tttctggcgc tatggtggag
      181 aaaaagaaat cgcttcagct gctgcgaatg gtgcgctctt ccctgaaaat catctacaac
      241 gatcacttct gttggacctt catcaagagc tatgggctct tctccttggc catcccgctg
      301 gccaagtacc ttgatggctt ccaaatattg cccaacgggg gcatctaatt ctttgttcta
      361 atatacgtaa attacatgtt gattgaacaa ggcaaccagt cgaactgtaa aa