PREDICTED: Drosophila takahashii zinc finger and BTB

LOCUS       XM_017157093             666 bp    mRNA    linear   INV 09-DEC-2024
            domain-containing protein 45 (LOC108067842), mRNA.
ACCESSION   XM_017157093
VERSION     XM_017157093.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157093.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..666
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..666
                     /gene="LOC108067842"
                     /note="zinc finger and BTB domain-containing protein 45;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 Proteins"
                     /db_xref="GeneID:108067842"
     CDS             138..605
                     /gene="LOC108067842"
                     /codon_start=1
                     /product="zinc finger and BTB domain-containing protein
                     45"
                     /protein_id="XP_017012582.2"
                     /db_xref="GeneID:108067842"
                     /translation="MFSIFGKRKPAETPTEDQPIQGPAEGPRPGTSGDDFVFIERKPG
                     PDAPPPSALPFASPGPMYPPMPPAGYLPYPPMPGARGSPAKLPGAQVPGPVNYLQDIP
                     FELAPELATKDRYASTQMQVDSILALLTRQMSVDELAEEYTFALERSVQNECY"
     polyA_site      666
                     /gene="LOC108067842"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 aaggtcacaa atataaaaat tcaaatagtc actcacgcac ttggctagaa aaccgccaaa
       61 gccccatctc agctggccga cgacgcaatt tgccaattta caaaggcaat agaaatagaa
      121 ttatattaaa tagtgccatg ttctcgatct ttgggaagcg caagcccgcc gagacgccga
      181 cggaggatca gcccatccag ggtccggcgg aggggccgcg gccagggacc agtggcgatg
      241 acttcgtctt catagagcgg aagcccggac cggatgctcc gccgccatcc gccctgccct
      301 tcgcctcccc gggccccatg tacccgccca tgccgccggc gggctacctg ccctacccgc
      361 ccatgccggg cgccagggga tcgccggcga agctgcccgg cgcccaggta cccggacccg
      421 tcaactactt gcaggacatt cccttcgagc tggcgcccga attggccacc aaggaccgct
      481 atgccagcac ccagatgcag gtggacagca tcctggcgct gctcacgcgc caaatgtccg
      541 tcgacgagct ggccgaggag tacaccttcg ccctggagag atccgtgcag aacgagtgct
      601 actagcctta gtccttaact catttcactg gttattataa taaaacgttg cctatttaat
      661 tgtaaa