Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii tRNA


LOCUS       XM_017157041            1451 bp    mRNA    linear   INV 09-DEC-2024
            (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho
            (wuho), mRNA.
ACCESSION   XM_017157041
VERSION     XM_017157041.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017157041.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1451
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1451
                     /gene="wuho"
                     /note="tRNA (guanine-N(7)-)-methyltransferase
                     non-catalytic subunit wuho; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 3
                     Proteins"
                     /db_xref="GeneID:108067818"
     CDS             107..1351
                     /gene="wuho"
                     /codon_start=1
                     /product="tRNA (guanine-N(7)-)-methyltransferase
                     non-catalytic subunit wuho"
                     /protein_id="XP_017012530.2"
                     /db_xref="GeneID:108067818"
                     /translation="MCVREAATILFAEPELVLGHGRRVLFVNPDDLQIFKEIELPPDL
                     GLKSDSARESSAAAAAGPSSGGKEQQLAKEAGGSGSGSIPGNSTALVQNVAYSPDGQL
                     LAVTTSGGQKALLLYKMRPENARLLSARPLARAASALRFCSDSSSVLVTDKTGDCYQY
                     DCVEAEATPRLLLGHLSVVYDILWSEDQQHIITCDRDDKIRVTNYPATFDIHSYCLGH
                     REFVSGLALLSDRHIVSSSGDKTLRVWNFILGKELLQHELPAPAVRLQVRQLEPEKVY
                     QAAVLFYDHVDALGLYRLERSSSEDEDKWSVTASQLVRAEAGSWSISNFTLTADRIYV
                     TGAEDQRLSLRVYDIATGQPVTSGVPEGWLQMVLEGLGANEAPFVPEDLSVWFKKRFD
                     NVSDYLERKKRRIEEQQQQKCG"
     misc_feature    <368..898
                     /gene="wuho"
                     /note="WD40 repeat [General function prediction only];
                     Region: WD40; COG2319"
                     /db_xref="CDD:441893"
     misc_feature    380..499
                     /gene="wuho"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    512..625
                     /gene="wuho"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    644..736
                     /gene="wuho"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     polyA_site      1451
                     /gene="wuho"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 taacttcgat ctggcaacac tgcgacgtga ggccacctcc agccattcat tccattcatt
       61 cctgcagcga agagtcaagc gagctccaag ttttcagttc tcggaaatgt gcgtcaggga
      121 agcggccact attctgttcg cggaacccga actggtgctc ggccatggcc gcagggtgct
      181 gttcgtgaac cccgacgacc tgcagatatt caaggagatc gagctgccgc ccgaccttgg
      241 cctgaagagc gattctgccc gggaatcctc tgcagctgca gcagcgggcc cttcttcggg
      301 cggcaaggag caacagctgg ccaaggaggc gggaggatcc ggatccggat ccataccggg
      361 caactccacc gctctggtgc agaatgtggc ctactccccg gacggacagc tgctcgccgt
      421 gaccaccagt gggggccaga aggctttgct gctctataaa atgcgcccgg agaacgcccg
      481 cctgctctcc gcccgcccac tggcacgggc ggccagcgcg ctgcgcttct gcagcgacag
      541 cagctccgtt ttggtcaccg acaagacggg cgactgctat cagtacgact gcgtcgaggc
      601 ggaggccact ccgcgcctgc tgctcggcca cctgagcgtg gtgtacgaca ttctgtggtc
      661 cgaggaccag cagcacatca tcacctgcga ccgggacgac aagatacgcg tgaccaacta
      721 tcccgccacc ttcgacatcc acagctattg cctcggccac cgggagtttg tctctggtct
      781 agcgctgctc tcggatcggc acattgtctc ttcgtcgggc gacaagacgc tgcgcgtgtg
      841 gaacttcatc ctgggcaagg agctgctgca gcacgagctt cccgcaccgg cggtacgtct
      901 ccaggtgcga caattggagc cggagaaggt ttaccaggcg gccgtgctct tctacgacca
      961 tgtggatgcc ttggggctgt atcgtttgga gcgcagctcc tccgaggacg aggacaagtg
     1021 gagcgtgacg gccagccagt tggtgcgcgc agaggcgggc tcgtggagca taagcaactt
     1081 tactttaacc gccgatcgga tctatgtcac gggagccgag gatcagcgat tgagcctgcg
     1141 ggtctacgac atcgccacgg gtcagccggt caccagtgga gtgcccgagg gctggctaca
     1201 gatggtgctg gaggggctgg gcgccaacga ggcgcctttc gtgcccgagg atctgtccgt
     1261 ttggttcaag aagcgcttcg acaacgtcag cgactatttg gagcgcaaga agcggcgcat
     1321 cgaggagcag cagcagcaga agtgcggcta atcaacccaa aaagggaaat ttaaatcttt
     1381 acatagcatt taattagcat atggagcagc agagcagcat ctaatatata tatctgtata
     1441 tgtgtgtaaa a