Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017157041 1451 bp mRNA linear INV 09-DEC-2024 (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho (wuho), mRNA. ACCESSION XM_017157041 VERSION XM_017157041.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017157041.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1451 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1451 /gene="wuho" /note="tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108067818" CDS 107..1351 /gene="wuho" /codon_start=1 /product="tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho" /protein_id="XP_017012530.2" /db_xref="GeneID:108067818" /translation="MCVREAATILFAEPELVLGHGRRVLFVNPDDLQIFKEIELPPDL GLKSDSARESSAAAAAGPSSGGKEQQLAKEAGGSGSGSIPGNSTALVQNVAYSPDGQL LAVTTSGGQKALLLYKMRPENARLLSARPLARAASALRFCSDSSSVLVTDKTGDCYQY DCVEAEATPRLLLGHLSVVYDILWSEDQQHIITCDRDDKIRVTNYPATFDIHSYCLGH REFVSGLALLSDRHIVSSSGDKTLRVWNFILGKELLQHELPAPAVRLQVRQLEPEKVY QAAVLFYDHVDALGLYRLERSSSEDEDKWSVTASQLVRAEAGSWSISNFTLTADRIYV TGAEDQRLSLRVYDIATGQPVTSGVPEGWLQMVLEGLGANEAPFVPEDLSVWFKKRFD NVSDYLERKKRRIEEQQQQKCG" misc_feature <368..898 /gene="wuho" /note="WD40 repeat [General function prediction only]; Region: WD40; COG2319" /db_xref="CDD:441893" misc_feature 380..499 /gene="wuho" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 512..625 /gene="wuho" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 644..736 /gene="wuho" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" polyA_site 1451 /gene="wuho" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 taacttcgat ctggcaacac tgcgacgtga ggccacctcc agccattcat tccattcatt 61 cctgcagcga agagtcaagc gagctccaag ttttcagttc tcggaaatgt gcgtcaggga 121 agcggccact attctgttcg cggaacccga actggtgctc ggccatggcc gcagggtgct 181 gttcgtgaac cccgacgacc tgcagatatt caaggagatc gagctgccgc ccgaccttgg 241 cctgaagagc gattctgccc gggaatcctc tgcagctgca gcagcgggcc cttcttcggg 301 cggcaaggag caacagctgg ccaaggaggc gggaggatcc ggatccggat ccataccggg 361 caactccacc gctctggtgc agaatgtggc ctactccccg gacggacagc tgctcgccgt 421 gaccaccagt gggggccaga aggctttgct gctctataaa atgcgcccgg agaacgcccg 481 cctgctctcc gcccgcccac tggcacgggc ggccagcgcg ctgcgcttct gcagcgacag 541 cagctccgtt ttggtcaccg acaagacggg cgactgctat cagtacgact gcgtcgaggc 601 ggaggccact ccgcgcctgc tgctcggcca cctgagcgtg gtgtacgaca ttctgtggtc 661 cgaggaccag cagcacatca tcacctgcga ccgggacgac aagatacgcg tgaccaacta 721 tcccgccacc ttcgacatcc acagctattg cctcggccac cgggagtttg tctctggtct 781 agcgctgctc tcggatcggc acattgtctc ttcgtcgggc gacaagacgc tgcgcgtgtg 841 gaacttcatc ctgggcaagg agctgctgca gcacgagctt cccgcaccgg cggtacgtct 901 ccaggtgcga caattggagc cggagaaggt ttaccaggcg gccgtgctct tctacgacca 961 tgtggatgcc ttggggctgt atcgtttgga gcgcagctcc tccgaggacg aggacaagtg 1021 gagcgtgacg gccagccagt tggtgcgcgc agaggcgggc tcgtggagca taagcaactt 1081 tactttaacc gccgatcgga tctatgtcac gggagccgag gatcagcgat tgagcctgcg 1141 ggtctacgac atcgccacgg gtcagccggt caccagtgga gtgcccgagg gctggctaca 1201 gatggtgctg gaggggctgg gcgccaacga ggcgcctttc gtgcccgagg atctgtccgt 1261 ttggttcaag aagcgcttcg acaacgtcag cgactatttg gagcgcaaga agcggcgcat 1321 cgaggagcag cagcagcaga agtgcggcta atcaacccaa aaagggaaat ttaaatcttt 1381 acatagcatt taattagcat atggagcagc agagcagcat ctaatatata tatctgtata 1441 tgtgtgtaaa a