Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii diphthine methyltransferase


LOCUS       XM_017156936            1391 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108067749), mRNA.
ACCESSION   XM_017156936
VERSION     XM_017156936.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156936.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1391
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1391
                     /gene="LOC108067749"
                     /note="diphthine methyltransferase; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108067749"
     CDS             238..1308
                     /gene="LOC108067749"
                     /codon_start=1
                     /product="diphthine methyltransferase"
                     /protein_id="XP_017012425.2"
                     /db_xref="GeneID:108067749"
                     /translation="MFTTLHSEDTEYSADSVEFLPQDDPEEEGYFACGTYQLVQEEGE
                     HEQEASPKCPRKGRVYLYHFADSNSRLQRLQCIETAAILDMKWLPACRDDGAAHLATV
                     NSLGQLETYEFLRDEQKLERRTCFCLAEEQDQEAPLALSLDWRREQAIQLAVSDSKGG
                     LHLLKCSPQGEIIRERSWSSGHGFEAWTCAFDRWSPHLLYSGGDDMLLLAHDLRTEQR
                     AWSNRTHMAGVTCLLSHPRHEHHLLTGSYDEQLRLFDTRAMRRPLAELNLGGGIWRLK
                     PHPLASDLLLAACMYTNFSVVQLDASAPGLSLLGAYEEHASICYGADWAPFRSRDDGS
                     LTMATCSFYDHKLCVSRVEIGK"
     misc_feature    484..657
                     /gene="LOC108067749"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    685..777
                     /gene="LOC108067749"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    778..>1008
                     /gene="LOC108067749"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cl29593"
                     /db_xref="CDD:475233"
     misc_feature    799..903
                     /gene="LOC108067749"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    922..1038
                     /gene="LOC108067749"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1051..1176
                     /gene="LOC108067749"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1192..1284
                     /gene="LOC108067749"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
ORIGIN      
        1 aagtccccta agataacgaa acactgtgac gccccgaaaa aagtcgaaga aatatgcagc
       61 taacaactac ggaggaggga cgagatcaac taaacctaat caagaatatg tagcgcgtaa
      121 acagagcact aagtagttag agatcaaaag gcaacggtcg attggcgggg cgatgtattt
      181 gtaagcggag aagaagaagc atcgatggcc gataattatc gatagccgac tgccagcatg
      241 tttacaacgc tccacagcga ggacacggaa tactcggcgg attccgtgga gttcctgccg
      301 caggatgatc cggaggagga gggctacttt gcctgcggca cctaccagct ggttcaggag
      361 gagggggagc atgagcagga ggcgtcaccc aagtgcccac gcaagggccg cgtttacttg
      421 taccacttcg ccgactcgaa ttcccgcctg cagcggctgc agtgcatcga aacggcggcc
      481 atactggaca tgaagtggtt gccggcctgc agggatgatg gagctgccca cctggcgacg
      541 gtcaactcgc tgggtcagct ggaaacctat gaattcctac gggacgagca gaagctggag
      601 aggcgcacgt gcttttgcct ggcggaggag caggatcagg aagccccctt ggctctgtcc
      661 ctggactggc ggcgggagca ggcgatccag ctggccgtct ccgactccaa gggtggcctg
      721 catctgctca agtgctcccc gcagggtgag attatccggg agcgctcgtg gtcatctgga
      781 catggcttcg aggcctggac ctgcgccttc gatcgctggt cgccgcacct cctgtacagc
      841 ggcggcgacg acatgctcct gctggcccac gacctgcgca cggagcagcg cgcctggagc
      901 aaccggacgc acatggccgg cgtcacctgc ctgctgagtc atccgcggca cgagcaccat
      961 ttgctcacgg gcagctacga cgagcagctg cgcctgttcg acacccgggc gatgaggcga
     1021 cctctggccg aattgaacct gggcggcggc atctggcggc tgaagccgca tcccctggcc
     1081 agcgatctcc tcctggccgc ctgcatgtac accaacttca gtgtggtgca gctggacgcc
     1141 agtgcgcccg gcctgagcct gctgggcgcc tacgaggagc acgcgagcat ctgctacggc
     1201 gccgattggg ctccgtttcg gagcagggac gacggctcct tgaccatggc cacctgctcc
     1261 ttctacgatc acaagttgtg cgtcagtcgc gtggagattg gcaaataagt tggcattttt
     1321 ttgtatttaa attgatttaa gtgtagtttt atagggaatt gttttttaaa tacaaatttt
     1381 aaataaatgt g