Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017156936 1391 bp mRNA linear INV 09-DEC-2024 (LOC108067749), mRNA. ACCESSION XM_017156936 VERSION XM_017156936.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017156936.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1391 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1391 /gene="LOC108067749" /note="diphthine methyltransferase; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108067749" CDS 238..1308 /gene="LOC108067749" /codon_start=1 /product="diphthine methyltransferase" /protein_id="XP_017012425.2" /db_xref="GeneID:108067749" /translation="MFTTLHSEDTEYSADSVEFLPQDDPEEEGYFACGTYQLVQEEGE HEQEASPKCPRKGRVYLYHFADSNSRLQRLQCIETAAILDMKWLPACRDDGAAHLATV NSLGQLETYEFLRDEQKLERRTCFCLAEEQDQEAPLALSLDWRREQAIQLAVSDSKGG LHLLKCSPQGEIIRERSWSSGHGFEAWTCAFDRWSPHLLYSGGDDMLLLAHDLRTEQR AWSNRTHMAGVTCLLSHPRHEHHLLTGSYDEQLRLFDTRAMRRPLAELNLGGGIWRLK PHPLASDLLLAACMYTNFSVVQLDASAPGLSLLGAYEEHASICYGADWAPFRSRDDGS LTMATCSFYDHKLCVSRVEIGK" misc_feature 484..657 /gene="LOC108067749" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 685..777 /gene="LOC108067749" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 778..>1008 /gene="LOC108067749" /note="WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from...; Region: WD40; cl29593" /db_xref="CDD:475233" misc_feature 799..903 /gene="LOC108067749" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 922..1038 /gene="LOC108067749" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1051..1176 /gene="LOC108067749" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1192..1284 /gene="LOC108067749" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 aagtccccta agataacgaa acactgtgac gccccgaaaa aagtcgaaga aatatgcagc 61 taacaactac ggaggaggga cgagatcaac taaacctaat caagaatatg tagcgcgtaa 121 acagagcact aagtagttag agatcaaaag gcaacggtcg attggcgggg cgatgtattt 181 gtaagcggag aagaagaagc atcgatggcc gataattatc gatagccgac tgccagcatg 241 tttacaacgc tccacagcga ggacacggaa tactcggcgg attccgtgga gttcctgccg 301 caggatgatc cggaggagga gggctacttt gcctgcggca cctaccagct ggttcaggag 361 gagggggagc atgagcagga ggcgtcaccc aagtgcccac gcaagggccg cgtttacttg 421 taccacttcg ccgactcgaa ttcccgcctg cagcggctgc agtgcatcga aacggcggcc 481 atactggaca tgaagtggtt gccggcctgc agggatgatg gagctgccca cctggcgacg 541 gtcaactcgc tgggtcagct ggaaacctat gaattcctac gggacgagca gaagctggag 601 aggcgcacgt gcttttgcct ggcggaggag caggatcagg aagccccctt ggctctgtcc 661 ctggactggc ggcgggagca ggcgatccag ctggccgtct ccgactccaa gggtggcctg 721 catctgctca agtgctcccc gcagggtgag attatccggg agcgctcgtg gtcatctgga 781 catggcttcg aggcctggac ctgcgccttc gatcgctggt cgccgcacct cctgtacagc 841 ggcggcgacg acatgctcct gctggcccac gacctgcgca cggagcagcg cgcctggagc 901 aaccggacgc acatggccgg cgtcacctgc ctgctgagtc atccgcggca cgagcaccat 961 ttgctcacgg gcagctacga cgagcagctg cgcctgttcg acacccgggc gatgaggcga 1021 cctctggccg aattgaacct gggcggcggc atctggcggc tgaagccgca tcccctggcc 1081 agcgatctcc tcctggccgc ctgcatgtac accaacttca gtgtggtgca gctggacgcc 1141 agtgcgcccg gcctgagcct gctgggcgcc tacgaggagc acgcgagcat ctgctacggc 1201 gccgattggg ctccgtttcg gagcagggac gacggctcct tgaccatggc cacctgctcc 1261 ttctacgatc acaagttgtg cgtcagtcgc gtggagattg gcaaataagt tggcattttt 1321 ttgtatttaa attgatttaa gtgtagtttt atagggaatt gttttttaaa tacaaatttt 1381 aaataaatgt g