Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017156829 815 bp mRNA linear INV 09-DEC-2024 subunit ASHI (ND-ASHI), mRNA. ACCESSION XM_017156829 VERSION XM_017156829.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017156829.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..815 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..815 /gene="ND-ASHI" /note="NADH:ubiquinone oxidoreductase subunit ASHI; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins" /db_xref="GeneID:108067685" CDS 168..695 /gene="ND-ASHI" /codon_start=1 /product="NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial" /protein_id="XP_017012318.1" /db_xref="GeneID:108067685" /translation="MSAFVKTVALAQKLCAANPAVARQAVRSMAGWNKDYKPAPYPQT EKERLAAAKKYYLLPEEYKPYADDGLGYGDYPQVGGGLGVEAKDNYYPWDYPEHKRNQ HEPISANHDLYSEDRYSQAEQPRYKNSYYFVCFLGVMSGCLALYYWLEDKKMYRPVAA KQYPGDGRKHYTFEK" misc_feature 243..665 /gene="ND-ASHI" /note="NADH-ubiquinone oxidoreductase ASHI subunit (CI-ASHI or NDUFB8); Region: NDUF_B8; pfam05821" /db_xref="CDD:428637" polyA_site 815 /gene="ND-ASHI" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 tctaaatttc taaacttttc tgcacgcgct ataactatcg ctcgccaact atcgatagct 61 cacgctggcc aagcacgatt gttgcgcatc ggcaggcaaa cagctgtttc tgctgaaatc 121 ggaatcggaa ataaatttgt aactttttat tttgaagcga gccagcaatg tcggcgtttg 181 tgaaaaccgt ggccctggcc caaaagctgt gcgccgccaa tcccgccgtg gctcgccagg 241 cggtcaggag catggctggc tggaacaagg actacaagcc ggcgccctat ccgcagacgg 301 agaaggagcg cctggcggcg gccaagaagt actacctcct gccggaggag tacaaaccct 361 acgcggacga cggcctgggc tacggcgact atccgcaggt gggcggcggc ctgggcgtgg 421 aggccaagga caactactat ccctgggact atccggagca caagcgcaac cagcacgagc 481 cgatctctgc caatcacgat ctgtacagcg aggatcgcta ctcgcaggcg gaacagccgc 541 gctacaagaa ctcttactac ttcgtctgct tcctgggcgt catgtccggc tgcctggccc 601 tctactactg gctggaggac aagaagatgt accgcccggt ggccgccaag caatatccgg 661 gcgacggaag gaagcactac acgttcgaga agtaggatgg cctcgttttt agttcatagg 721 ccatctatca acgcatctgt acaattaaat tgaaaagaaa atatggataa ctagccaatg 781 gtcccgaaaa ataaaggaaa caacttgaaa aacaa