Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii NADH:ubiquinone oxidoreductase


LOCUS       XM_017156829             815 bp    mRNA    linear   INV 09-DEC-2024
            subunit ASHI (ND-ASHI), mRNA.
ACCESSION   XM_017156829
VERSION     XM_017156829.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156829.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..815
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..815
                     /gene="ND-ASHI"
                     /note="NADH:ubiquinone oxidoreductase subunit ASHI;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 4 Proteins"
                     /db_xref="GeneID:108067685"
     CDS             168..695
                     /gene="ND-ASHI"
                     /codon_start=1
                     /product="NADH dehydrogenase [ubiquinone] 1 beta
                     subcomplex subunit 8, mitochondrial"
                     /protein_id="XP_017012318.1"
                     /db_xref="GeneID:108067685"
                     /translation="MSAFVKTVALAQKLCAANPAVARQAVRSMAGWNKDYKPAPYPQT
                     EKERLAAAKKYYLLPEEYKPYADDGLGYGDYPQVGGGLGVEAKDNYYPWDYPEHKRNQ
                     HEPISANHDLYSEDRYSQAEQPRYKNSYYFVCFLGVMSGCLALYYWLEDKKMYRPVAA
                     KQYPGDGRKHYTFEK"
     misc_feature    243..665
                     /gene="ND-ASHI"
                     /note="NADH-ubiquinone oxidoreductase ASHI subunit
                     (CI-ASHI or NDUFB8); Region: NDUF_B8; pfam05821"
                     /db_xref="CDD:428637"
     polyA_site      815
                     /gene="ND-ASHI"
                     /experiment="COORDINATES: polyA evidence [ECO:0006239]"
ORIGIN      
        1 tctaaatttc taaacttttc tgcacgcgct ataactatcg ctcgccaact atcgatagct
       61 cacgctggcc aagcacgatt gttgcgcatc ggcaggcaaa cagctgtttc tgctgaaatc
      121 ggaatcggaa ataaatttgt aactttttat tttgaagcga gccagcaatg tcggcgtttg
      181 tgaaaaccgt ggccctggcc caaaagctgt gcgccgccaa tcccgccgtg gctcgccagg
      241 cggtcaggag catggctggc tggaacaagg actacaagcc ggcgccctat ccgcagacgg
      301 agaaggagcg cctggcggcg gccaagaagt actacctcct gccggaggag tacaaaccct
      361 acgcggacga cggcctgggc tacggcgact atccgcaggt gggcggcggc ctgggcgtgg
      421 aggccaagga caactactat ccctgggact atccggagca caagcgcaac cagcacgagc
      481 cgatctctgc caatcacgat ctgtacagcg aggatcgcta ctcgcaggcg gaacagccgc
      541 gctacaagaa ctcttactac ttcgtctgct tcctgggcgt catgtccggc tgcctggccc
      601 tctactactg gctggaggac aagaagatgt accgcccggt ggccgccaag caatatccgg
      661 gcgacggaag gaagcactac acgttcgaga agtaggatgg cctcgttttt agttcatagg
      721 ccatctatca acgcatctgt acaattaaat tgaaaagaaa atatggataa ctagccaatg
      781 gtcccgaaaa ataaaggaaa caacttgaaa aacaa