Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii ubiquinone biosynthesis protein


LOCUS       XM_017156736             867 bp    mRNA    linear   INV 09-DEC-2024
            COQ7, mitochondrial (Coq7), transcript variant X1, mRNA.
ACCESSION   XM_017156736
VERSION     XM_017156736.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156736.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..867
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..867
                     /gene="Coq7"
                     /note="ubiquinone biosynthesis protein COQ7,
                     mitochondrial; Derived by automated computational analysis
                     using gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 25 Proteins"
                     /db_xref="GeneID:108067622"
     CDS             146..808
                     /gene="Coq7"
                     /codon_start=1
                     /product="5-demethoxyubiquinone hydroxylase, mitochondrial
                     isoform X1"
                     /protein_id="XP_017012225.2"
                     /db_xref="GeneID:108067622"
                     /translation="MTGMLRGVLCAPQPRLLSLRRCLSSAAGGSAGSGVSGGSGEGTP
                     LRPRPNALTDEIIRVDHAGELGADRIYAGQMAILGNGPLGKTIGHMWEQEKEHRRQFE
                     QLIQQHRVRPTIMTPLWNVAGFVLGAGTALMGEKAAMACTVAVETVIVEHYNDQLRQI
                     MEAPHPDKELLATITKFRDEEQEHHDTGIDHGAEQAPFYAALTEVIKFGCKTAIAISK
                     KI"
     misc_feature    296..796
                     /gene="Coq7"
                     /note="Ubiquinone biosynthesis protein COQ7; Region: COQ7;
                     pfam03232"
                     /db_xref="CDD:460854"
ORIGIN      
        1 cggctgccca gtgcttgtcc catccctggt tgcattgcgc aaaaaataat aaacagaaga
       61 tctcgttttt gctcgccgaa ttggattgct attcatttta ccatttattt accaaatagc
      121 acccgagcaa agctgcagat ttgtgatgac cggaatgctg agaggagtcc tctgtgcgcc
      181 gcagccgcgt ctgctgtccc tgcgtcgctg cctcagctca gcggctggag gatctgcagg
      241 atcgggagta tcgggaggct ctggagaagg cactcccctg cgcccacgtc caaatgccct
      301 gactgacgag ataatacgcg tcgatcatgc cggcgaactg ggcgccgatc gcatctacgc
      361 cggccagatg gccattctgg gcaacgggcc gctgggcaag accatcggcc acatgtggga
      421 gcaggagaag gagcatcgcc gccagttcga gcagctcatc cagcagcatc gcgtccgtcc
      481 gacgatcatg acgccgctgt ggaacgtggc cggctttgtg ctgggcgccg gaacagcgct
      541 gatgggcgaa aaggcggcca tggcctgcac ggtggccgtg gagacggtga ttgtggagca
      601 ctacaacgat cagctgcgcc agatcatgga ggcaccgcat ccggacaagg agctgctggc
      661 cacgatcacc aagttccggg acgaggagca ggagcaccac gacaccggca tcgatcacgg
      721 ggccgagcag gcgcccttct acgcggccct gaccgaggtg atcaagttcg gctgcaagac
      781 ggccatagcc atctcgaaga agatctagat ctagatctag atacataaag atcccctgta
      841 tataccacac actataagca ttaaaga