Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017156718 1814 bp mRNA linear INV 09-DEC-2024 transcript variant X3, mRNA. ACCESSION XM_017156718 VERSION XM_017156718.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017156718.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1814 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1814 /gene="shf" /note="WNT inhibitory factor 1; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins" /db_xref="GeneID:108067595" CDS 288..1646 /gene="shf" /codon_start=1 /product="protein shifted isoform X3" /protein_id="XP_017012207.1" /db_xref="GeneID:108067595" /translation="MSHQGIGCLVKWFYLVLIVHTLLCIGQLECRQHQHNRNNNNNNS NNNRRSDSSSSEESHGNASDGLDNYADHDIGGPGGPQPRRGQRKKHQGGGGGGGGGGG GGGGGNGNGGGGGNRNNRNEESGISLWINEQQLKMLTALYFPQGYSERLYAIHNSRVT NDLRDTTLYNFLVIPSEVNYVNFTWKSGRRKYFYDFDRLQTMDESILKAPTLSIRKSG RIPQEQKNFSIFLPCTGNSSGTASFNVGLKIQTRHNKPLSGTPIRLNFKKECAHRAPD PECSLKCGKNGYCNEQHICKCNVGYTGQYCETAFCFPQCLNGGNCTAPSICTCPEGYQ GTQCEGGICKDKCLNGGKCIQKDKCQCSKGYYGLRCEYSKCVIPCKNEGRCIGNNLCR CPNGLRGDHCEIGRKQRSICKCRNGTCTSHKHCKCHPGFYGRHCNGRKQRHVHRNDDS KF" misc_feature 672..1088 /gene="shf" /note="WIF domain; Region: WIF; cl02623" /db_xref="CDD:470637" polyA_site 1814 /gene="shf" /experiment="COORDINATES: polyA evidence [ECO:0006239]" ORIGIN 1 agctaaggag ctgcagcgcg acggtcgcac ccgaaactct gcgcgatatt gtattctcag 61 aggccaattc tgttcgcgtt tgtgtccaaa caaaaaagct tcgacgctac ggaattcgtg 121 aaaaatcgaa ggctcaagga attcggcaaa taaaagtgta tatatttttt gtggacttgt 181 caaccatttt tgatttgtca accgagtcaa caacggccaa tccaaccgaa gcgactgttt 241 attgcctttt tttttgggtc cggcgacggc caacgactgg ggaaactatg agccatcagg 301 gcatcggctg cctggtcaag tggttctatc tggtgctgat cgtgcacacg ctcctctgca 361 tcggccagct cgagtgtcgc cagcaccagc acaatcggaa caataacaat aacaatagca 421 acaacaacag aagatcggac tcgtccagtt cggaggagag ccacggcaac gccagcgatg 481 gcctggacaa ctatgcggac cacgacatcg gtggtcctgg tggtccccag ccgcgacggg 541 gtcagcggaa gaaacaccag ggcggcggcg gaggaggagg aggaggaggc ggcggcggag 601 gaggaggaaa cggaaacgga ggaggcggtg gcaaccggaa caaccgcaac gaggagagcg 661 gcatctcgct gtggatcaac gagcagcagc tcaagatgct cactgcgctc tacttcccgc 721 agggctactc ggaacgcctg tacgccatcc acaacagccg ggtgaccaac gatctgcgcg 781 acaccacgct gtacaacttc ctggtgatcc cgtccgaggt gaactacgtg aacttcacgt 841 ggaagtcggg gcggcgcaag tacttctacg acttcgatcg cctgcagacg atggacgaga 901 gcatcctgaa ggcgcccacg ctgtccatcc gcaagagcgg ccgcattccg caggagcaga 961 agaatttcag catcttcctg ccctgcaccg gcaacagctc cggcaccgcg tccttcaacg 1021 tcggcctcaa gatccagacg cgccacaaca agccgctctc aggcacaccc attcgactca 1081 acttcaaaaa ggaatgcgcc cacagagctc ccgatccaga atgcagcttg aagtgcggca 1141 agaacggcta ctgcaacgag cagcacattt gcaagtgcaa cgtgggctac acgggccagt 1201 actgcgagac ggccttctgc ttcccgcagt gcctcaacgg gggcaactgc acggcgccgt 1261 cgatctgcac ctgtccggag ggctaccagg gcacccagtg cgaaggtggt atttgcaagg 1321 acaagtgcct gaatggcggc aagtgcatac agaaggacaa gtgccagtgc tccaagggat 1381 actacggcct gcgctgcgag tactccaagt gcgtgattcc ctgcaagaac gagggtcgct 1441 gcatcgggaa caacctgtgc cgctgcccca atggattgcg gggcgatcac tgcgagatcg 1501 gacgcaagca gcgctccatt tgcaagtgcc gcaatggcac ctgcacctcc cacaagcact 1561 gcaagtgcca tccgggattc tatgggcgcc actgcaacgg ccgcaagcag cgacatgtcc 1621 accgaaacga cgactccaag ttctaggatc catcgtaata tccattcaac tttacacact 1681 tttctattaa aaagcacaac gactacaaca acaacagcga caaaaggatg aaacgaaaat 1741 aattctaatt gtgataaaat ttttttgtaa tttaacataa caattttaaa taaaacacga 1801 aatctaagag ttga