Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_017156700 1197 bp mRNA linear INV 09-DEC-2024 (LOC108067596), transcript variant X1, mRNA. ACCESSION XM_017156700 VERSION XM_017156700.3 DBLINK BioProject: PRJNA1194641 KEYWORDS RefSeq. SOURCE Drosophila takahashii ORGANISM Drosophila takahashii Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NC_091683) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On Dec 9, 2024 this sequence version replaced XM_017156700.2. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_030179915.1-RS_2024_12 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 10.3 Annotation Method :: Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/07/2024 ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1197 /organism="Drosophila takahashii" /mol_type="mRNA" /strain="IR98-3 E-12201" /db_xref="taxon:29030" /chromosome="X" /sex="female" /tissue_type="Whole fly" /dev_stage="Adult fly" /collected_by="Originally obtained from EHIME-Fly" gene 1..1197 /gene="LOC108067596" /note="uncharacterized LOC108067596; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins" /db_xref="GeneID:108067596" CDS 91..1053 /gene="LOC108067596" /codon_start=1 /product="uncharacterized protein isoform X1" /protein_id="XP_017012189.2" /db_xref="GeneID:108067596" /translation="MCIIKSKKEKHITRIQSLRPNQMEEYPMNHMVRPQGFSLEELRQ TLGQSVIREQCYFIYGTCNVLEIIAGFDELLNQEEIEFGAEQLAPVYVTGMMVYLLNH EDMAATQVKRTLFLQKCFDYLACTEETHIHQICVYILGLLDANDSSVMLNLILCCRVA SPLSTMARVVGNCLLWAMLDRLSDLGLDSHRLRASGTLLLVVAVVKPRIYVQSYLHAL HLVVRLVSSLLVVGPLGAHGQQLCQETGVPEELMQLSKEDSSILVRWLIAIVEELRPQ MVQNEDLGHLHERLVLLEAICELMQLLHGHLVKCYQERKDLAPK" ORIGIN 1 ataacctcac ttttagctac attgaggtta cgttgcagaa agagaggtta ggtttttacc 61 tcttaccaat gtgtttttat aaacaaatac atgtgcataa ttaaaagcaa aaaagaaaag 121 catataacac gcatacaaag cctaagaccg aatcaaatgg aggaataccc catgaaccat 181 atggtgcgac cccagggctt cagtttggag gagctgcgtc agactttggg tcagtccgtc 241 attcgagaac aatgctactt catctatggc acctgcaatg ttctcgagat tatcgcagga 301 ttcgatgaac tgctcaacca ggaggagatt gagttcggag cggagcaact ggctccggtg 361 tatgtgaccg ggatgatggt atatctactc aatcacgagg atatggcggc gacccaggtg 421 aagaggacac tattcctgca gaagtgcttc gattatctgg cctgcactga ggaaacgcac 481 atccaccaga tatgcgtgta tatcctgggc cttttggatg ccaacgactc gagcgtaatg 541 ctgaacctga tcctctgctg ccgggtggcc agtccactga gcacaatggc ccgcgtggtg 601 ggcaactgtc tgctctgggc catgttggat cgcctatcgg acttgggcct ggactcacac 661 cgattgcggg catctgggac tctgctgctc gtcgtcgcgg tggtgaagcc ccggatttac 721 gttcaatcct atctgcatgc cctgcacctg gtggtccgct tggtgtccag tctcctggtg 781 gttggaccac tcggtgcaca tggccagcaa ctttgccagg aaaccggtgt gccggaagaa 841 ctgatgcaac tctccaagga ggactcctcg attttggtgc gctggctaat cgctatcgtt 901 gaggagctgc gtccgcaaat ggtgcagaac gaggatctgg gacacctgca tgagcgtctg 961 gtgctcctgg aggccatatg tgagctcatg caactcctgc atggccattt ggttaagtgc 1021 taccaggaaa gaaaagatct ggcaccaaag tagcttgcaa atgtggtaga tttagcaatt 1081 tcaagttaaa agcttttggg atcctaaaca tttttatcaa tataaacacc actttttata 1141 atattcttat aatattaaat aatagttttt cggaaaaact ttttccctca aataagt