Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila takahashii uncharacterized protein


LOCUS       XM_017156700            1197 bp    mRNA    linear   INV 09-DEC-2024
            (LOC108067596), transcript variant X1, mRNA.
ACCESSION   XM_017156700
VERSION     XM_017156700.3
DBLINK      BioProject: PRJNA1194641
KEYWORDS    RefSeq.
SOURCE      Drosophila takahashii
  ORGANISM  Drosophila takahashii
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_091683) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On Dec 9, 2024 this sequence version replaced XM_017156700.2.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_030179915.1-RS_2024_12
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.3
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 12/07/2024
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1197
                     /organism="Drosophila takahashii"
                     /mol_type="mRNA"
                     /strain="IR98-3 E-12201"
                     /db_xref="taxon:29030"
                     /chromosome="X"
                     /sex="female"
                     /tissue_type="Whole fly"
                     /dev_stage="Adult fly"
                     /collected_by="Originally obtained from EHIME-Fly"
     gene            1..1197
                     /gene="LOC108067596"
                     /note="uncharacterized LOC108067596; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 2
                     Proteins"
                     /db_xref="GeneID:108067596"
     CDS             91..1053
                     /gene="LOC108067596"
                     /codon_start=1
                     /product="uncharacterized protein isoform X1"
                     /protein_id="XP_017012189.2"
                     /db_xref="GeneID:108067596"
                     /translation="MCIIKSKKEKHITRIQSLRPNQMEEYPMNHMVRPQGFSLEELRQ
                     TLGQSVIREQCYFIYGTCNVLEIIAGFDELLNQEEIEFGAEQLAPVYVTGMMVYLLNH
                     EDMAATQVKRTLFLQKCFDYLACTEETHIHQICVYILGLLDANDSSVMLNLILCCRVA
                     SPLSTMARVVGNCLLWAMLDRLSDLGLDSHRLRASGTLLLVVAVVKPRIYVQSYLHAL
                     HLVVRLVSSLLVVGPLGAHGQQLCQETGVPEELMQLSKEDSSILVRWLIAIVEELRPQ
                     MVQNEDLGHLHERLVLLEAICELMQLLHGHLVKCYQERKDLAPK"
ORIGIN      
        1 ataacctcac ttttagctac attgaggtta cgttgcagaa agagaggtta ggtttttacc
       61 tcttaccaat gtgtttttat aaacaaatac atgtgcataa ttaaaagcaa aaaagaaaag
      121 catataacac gcatacaaag cctaagaccg aatcaaatgg aggaataccc catgaaccat
      181 atggtgcgac cccagggctt cagtttggag gagctgcgtc agactttggg tcagtccgtc
      241 attcgagaac aatgctactt catctatggc acctgcaatg ttctcgagat tatcgcagga
      301 ttcgatgaac tgctcaacca ggaggagatt gagttcggag cggagcaact ggctccggtg
      361 tatgtgaccg ggatgatggt atatctactc aatcacgagg atatggcggc gacccaggtg
      421 aagaggacac tattcctgca gaagtgcttc gattatctgg cctgcactga ggaaacgcac
      481 atccaccaga tatgcgtgta tatcctgggc cttttggatg ccaacgactc gagcgtaatg
      541 ctgaacctga tcctctgctg ccgggtggcc agtccactga gcacaatggc ccgcgtggtg
      601 ggcaactgtc tgctctgggc catgttggat cgcctatcgg acttgggcct ggactcacac
      661 cgattgcggg catctgggac tctgctgctc gtcgtcgcgg tggtgaagcc ccggatttac
      721 gttcaatcct atctgcatgc cctgcacctg gtggtccgct tggtgtccag tctcctggtg
      781 gttggaccac tcggtgcaca tggccagcaa ctttgccagg aaaccggtgt gccggaagaa
      841 ctgatgcaac tctccaagga ggactcctcg attttggtgc gctggctaat cgctatcgtt
      901 gaggagctgc gtccgcaaat ggtgcagaac gaggatctgg gacacctgca tgagcgtctg
      961 gtgctcctgg aggccatatg tgagctcatg caactcctgc atggccattt ggttaagtgc
     1021 taccaggaaa gaaaagatct ggcaccaaag tagcttgcaa atgtggtaga tttagcaatt
     1081 tcaagttaaa agcttttggg atcctaaaca tttttatcaa tataaacacc actttttata
     1141 atattcttat aatattaaat aatagttttt cggaaaaact ttttccctca aataagt